KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c05870Help
Entry
PGA2_c05870       CDS       T02193                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGA2_c05870 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGA2_c05870 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PGA2_c05870 (thrC)
Enzymes [BR:pgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PGA2_c05870 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650205..651593
Genome map
AA seq 462 aa AA seqDB search
MKYISTRGQAPELTFEDAMLTGLARDGGLYVPAEIPTMSKDEIAALAGLSYEEVAFRVMR
PFLGDCFTDEEFRGIIARAYDGFGHAARAPLVQLAPNHFLLELFHGPTLAFKDFAMQLIG
QLFETALKRRGESVTIVGATSGDTGSAAIQAFGGLDAVNVFILYPHGRVSEVQRRQMTTP
TDANVHALAVDGDFDDCQAALKDMFNDFDFRDEVRLAGVNSINFARVLAQVVYYFTSAVS
LGAPERKVSFTVPTGNFGDIFAGFIAKQMGLPIDQLVVATNQNDILHRCLSGQGYHKGET
IPSISPSMDIQVSSNFERALFYAYGKDGAAVAQLMDELKTGGFEVSQGAMQALQEHYVSG
RCSEEETSATIKSERAASGELLCPHSAIGVKVANEQRDAAVPMVTLATAHPAKFPAAVEE
ASGIHPPLPPRMADLYDRSERVTRIANDLTTLETHIRKHIAH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatctcgacccggggccaggcgcctgagctgacctttgaagatgctatgctg
accgggcttgcccgcgacggcgggctttatgttccggccgaaatcccgaccatgtccaag
gatgagatcgcggcccttgccggtctctcctatgaggaggtcgcgtttcgcgtgatgcgc
ccgttccttggcgattgcttcacggacgaggaattccgcggcatcatcgcccgcgcctat
gacggctttggccatgccgcccgtgcgccgctggtgcagctggcgccgaaccatttcctg
ctggagctgtttcacggcccaacactggcgttcaaagattttgccatgcagctgatcggc
cagctgtttgaaaccgcgttgaagcggcgcggcgaaagcgtgaccatcgtcggcgcgacc
tccggcgataccggctctgcggccattcaggcctttggtggcttggatgcggtcaatgtc
ttcatcctctatccgcatggccgggtgtccgaggtgcagcgccgccagatgaccacgccc
accgatgccaatgtgcatgcgcttgccgtggatggtgattttgacgattgccaggccgcg
ctgaaggatatgttcaacgacttcgacttccgggatgaggtcagattggccggcgtgaac
tcgatcaactttgcccgcgtgctggcacaggtggtctattacttcacctccgccgtgtcg
ctgggcgcaccagagcgcaaggtgagcttcaccgtgccgaccggcaatttcggcgacatc
ttcgcgggtttcatcgcgaagcaaatgggcctgccgattgaccagctggtggtggccacc
aatcagaacgacattctgcaccgctgcctgagcgggcagggctatcacaagggcgaaacc
atcccgtcgatctcgccgtcgatggacattcaggtctcgtctaactttgaacgcgcgctg
ttctatgcctacgggaaggatggtgcggcagtggctcagctgatggacgagctgaaaact
ggcggtttcgaggtgagccagggcgctatgcaggccctgcaggagcattacgtgtccggt
cgctgctcggaagaagaaacctctgccaccatcaaatcggagcgcgctgcctcgggtgag
ctgctctgcccacacagcgccattggcgtgaaagttgcgaatgaacagcgcgacgcagcg
gtcccgatggtgacgctcgccacggcgcacccggcgaaattcccggcggcggtagaagag
gccagcggcattcatccgcctcttcccccgcgcatggcagatctgtatgacagatcggaa
cgggtgacacggatcgctaatgacctgaccactcttgagacacatatcagaaagcacatc
gcgcattga

DBGET integrated database retrieval system