KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c06100Help
Entry
PGA2_c06100       CDS       T02193                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676689..677684
Genome map
AA seq 331 aa AA seqDB search
MSYYRPLVQHGENRPEGALSLISGALWFTQVEVLDRGAPPRLMPAGLLPEDVRHRLTARR
ATIAGLDMTQPQIMGILNVTPDSFSDGGQHDEVGTACAVALQMVADGASIIDVGGESTRP
GAVLVPEEEEIRRTAPVIAAIRAKSQVPISIDTRKAVVLAEALEAGASLTNDVSGFTFDP
ALAPLTAQAGVPACIMHAQGDPATMQDSPTYDNVLLDVYDFLKAQIDRLEDIGVVREQIV
IDPGIGFGKTLEHNLTLLRNLSLFHGLGCPILLGVSRKGFIGKLGHEPDAAARGPGSIAV
GLAALAQGVQFLRVHDVAETVQAVRLWQAVR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgagttattaccggccgctggttcagcacggggaaaaccgccccgagggagcgttgtcg
ctgatcagtggcgctctttggtttactcaagtcgaagttctggaccgcggtgcgccgcca
cggctgatgcctgcggggctgctgcccgaagatgtccggcaccggctgaccgcgcgccgc
gcgacgatcgctgggctggatatgacccagccgcagatcatgggcattctgaatgtgacg
cctgacagtttttccgatggtggtcagcacgatgaggttggcacggcctgcgcggttgcg
ctgcagatggtggctgatggtgccagtattatcgatgttggcggcgaatccacccgcccc
ggtgctgttctggtccctgaggaggaggagattcgtcgcaccgcgccggtgatcgccgcg
atccgagccaagtcgcaggttccgatttctatcgacacccgcaaggccgtggtgctggca
gaggcgctggaagctggtgcaagcctcaccaatgatgtgtccggctttacctttgacccg
gcgctggccccgttgacggcccaggccggggtacctgcctgtatcatgcatgcgcagggc
gatcccgcgacgatgcaggacagtccgacctatgacaatgtgttgctcgacgtgtatgac
tttctcaaagcgcagattgaccggctggaggatatcggtgtcgtgcgcgagcagatcgtg
attgatcccggtatcggcttcggcaagacgctggagcacaatctgaccctgttgcgtaat
ctcagcctgtttcacggccttggctgtccgatcctgctgggcgtgtcccgcaaggggttc
attggcaagctggggcatgagccggatgccgccgcccgcgggccgggctccattgcggta
gggcttgcagccctggcccaaggcgtgcaattcctgcgggtgcatgatgttgctgagacg
gtgcaggcggttcgcctgtggcaggccgtccgataa

DBGET integrated database retrieval system