KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c06890Help
Entry
PGA2_c06890       CDS       T02193                                 

Gene name
rafA
Definition
alpha-galactosidase RafA (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PGA2_c06890 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    PGA2_c06890 (rafA)
   00600 Sphingolipid metabolism
    PGA2_c06890 (rafA)
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PGA2_c06890 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(765673..767772)
Genome map
AA seq 699 aa AA seqDB search
MSTVRDIRCWTLHDQRQSLILAAHGTDLAEVIYWGPRLPDGTDLEMLVAAAHMDVTGGML
DAVPPLSICPEARRSFPGQPGLSLTNSAGEALLPRFTFERAEEDDQTLTLLYHDAKNGLR
YRARFELTLATGMIRATASLTSEQPVSVNWLSAPVFPAPQNSHEMIDFHGRWIGEFQTSR
TPWSVGARLRDNPTGRTGHEHFPGLIVPCTGATNSQGSAYAFHYGWSGGHKMLAEELPDG
RRQIQWGHATSSRRSPGTQFKTAPLYAVFSDQGINGCAIAFQRHLRDKILQPPAPARPRP
VHYNCWEAVYFDHDHATLCDIASRAAALGAERFVLDDGWFGRRDDDTTSLGDWSIDRRKY
PDGLMPLINHVHAEGMTFGIWFEPEMINPDSDLFRTHPDWVLGDPDQVLGRQQMVLNIAL
PEVQAYLYERISAVLADHPIDYVKWDHNRVLPEPDSAQAEAIYVLFDRLRADFPTVEFES
CSSGGGRIDFGILSRTHRVWLSDSNDPLERLRIQHEAALFLPMVVTGSHVGPRKCHTSGR
ETDIRLRAWVAAQRHMGFEMDPRELTEEEADVLRQVTRWWKGNRHWTERADILRLDSDDP
AVIAELQRAEDGSRFVAFAGLSAASAQILPRPLRLTGLEPGTLYEISLLNRDDAPGLSRG
SPLLKTETARLSGQYLMHQGITLPWTFPQSIWVIEGTRL
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggtgagagatatccgctgttggacacttcacgatcagaggcaaagcctgatc
ctcgccgcccatggcacagatctggcggaggtcatttactgggggccgcgcctgcccgac
ggcaccgatctggaaatgcttgttgccgccgcgcacatggatgtgacgggggggatgctg
gacgccgtgccgccgctgtcgatctgccccgaggcgcgccgcagcttccccggccagccc
ggcctgtcactgacgaacagcgcaggcgaggcgctgttgccccgcttcacctttgaacgt
gccgaggaagatgatcagaccctcacccttctgtatcacgatgcgaaaaacgggctgcgc
tatcgcgcgcggttcgagctgacgctcgcaacaggcatgatccgcgcgacggcctctctc
acgtcagagcagccagtcagtgtgaactggctctctgcaccggtctttccggcacctcag
aacagtcacgagatgatcgatttccacggccgctggatcggagagtttcagaccagccgc
acgccctggagcgttggcgcgcgcctcagggacaaccccacagggcgcaccgggcatgag
catttccccggtctgatcgtgccctgcaccggtgccacgaacagccaaggatctgcctat
gcctttcactacggctggtctggtggccataaaatgctggcagaggaactgcccgacggg
cgtcgccagatccaatggggccatgcgaccagcagccgccgcagccccggcacccagttt
aagaccgcaccgctctatgccgtgttctcggatcaggggatcaatggctgcgccattgcc
ttccagcgtcatctgcgtgacaagatcctccagccccccgcccctgcgcgcccgcgaccg
gtgcattacaactgctgggaagcggtctatttcgaccatgatcacgctacgctctgcgat
attgcaagccgggctgcggcactaggggcagagcggtttgtgctggatgatggctggttc
ggcagacgggatgacgacaccacatcgctcggcgattggtccattgacagacgcaaatac
cccgatgggctgatgcctctgatcaaccacgtccacgcagaaggcatgacatttggcatc
tggtttgaaccggaaatgatcaacccggacagcgatctgtttcgcacccatcctgattgg
gttctgggcgatcctgatcaggtcctggggcgacagcagatggtgctgaatatcgcgctg
ccagaggttcaggcctatctctacgagcgcatctcagccgtacttgccgaccatcctatc
gactatgtgaaatgggatcacaatcgcgtcctcccggaaccagacagcgcgcaggccgag
gcgatttatgtgctctttgaccggctgcgggcagacttccctacggtggagtttgaaagt
tgttcatcaggcggcgggcgtattgactttggcatcctgtcgcgcacccaccgcgtctgg
ctctctgacagcaacgacccgcttgagcgattgcgcatccagcatgaagcggcgcttttc
ctgccgatggtggtcaccggcagccacgtaggcccccgaaaatgccacacctctggccgg
gagacagacatccgcctgcgcgcctgggtcgcggcgcagcgccacatggggtttgaaatg
gacccgcgcgagctgaccgaggaggaagcagacgtcctgcgccaggttacccgctggtgg
aaaggcaatcgtcactggacagagcgggcggatattctacggctcgacagcgacgatcct
gcggtcattgcggagttgcagcgcgcggaggatggcagtcggttcgtcgccttcgccggg
ctgagcgcggccagtgcccagatcctgccccgccctctgcgcctgaccgggctggagccg
ggtacactgtatgaaatcagcctgctgaaccgcgacgatgcccccggcctgtcgcgtggc
tcgccgctcctgaaaaccgaaaccgcccgtctcagcggccaatatctgatgcaccaaggg
atcaccctgccctggaccttcccgcagtcgatatgggtgattgaaggaacacgcctatga

DBGET integrated database retrieval system