KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c06990Help
Entry
PGA2_c06990       CDS       T02193                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGA2_c06990
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGA2_c06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(776924..777886)
Genome map
AA seq 320 aa AA seqDB search
MDAHLMDLTPAPFFADIARGPDGGQAHWVTTSDGLRIRVGHWHPDGAEKGTLLLFPGRTE
YIEKYGAAAQDLANRGYATLAVDWRGQGLADRLLPERLLGHVVAFRDFQKDVDAAVDLAE
RLALPKPWFVLGHSMGGAIGLRAVMEGLPVKACVFSAPMWGIQIPPALRPVARLLSAMGD
RFGIGAMRTPTTTLAPYVQASPFEGNSLTNDAEMYRLMQDQLAAQPDLSLGGPTVRWLGE
SLRECADLAQLPSPALPCITFLGTQEQIVNTAAIHDRMARWPGGELDLVEGAQHEVMMEG
AETRRTIFDKMTRLFDQYAD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcacctgatggatctgacccccgccccattctttgccgatatcgcgcgagga
cccgacggcggtcaggctcattgggtgaccaccagcgatggcctgcgcatccgcgtgggc
cattggcacccggatggtgccgaaaaaggcacgttgctactgtttccgggacgcaccgaa
tatattgagaaatacggcgcggccgcccaggacctggccaatcgcggctatgccacactg
gcggttgactggcgcggtcaggggcttgctgaccggctgctgcccgagcgccttctgggc
catgttgttgcgtttagagattttcagaaagatgtcgacgcggctgtagatctggccgag
cggctggcgttgccaaaaccctggtttgtacttgggcactccatgggcggggccattggg
cttcgcgccgtgatggaggggctgccagttaaggcctgcgtgttttccgccccgatgtgg
ggcattcagattcccccggccctgcgccctgtggcgcggctgctcagcgcaatgggcgac
cggttcggcatcggtgcgatgcggaccccgacaaccacgcttgcgccctatgtgcaggcc
agcccttttgagggcaattcgctcaccaatgatgcagagatgtatcgtctcatgcaggac
cagcttgccgcacagccggatctgtcgctcggcgggccaacggtgcgatggctgggagag
agtttgcgtgaatgcgctgatctcgcccaattgccctcgcccgcgctgccctgcatcacc
ttcctcgggacacaggagcagatcgtcaacaccgcagccatccatgatcgcatggcccgc
tggcccggtggggaactggatctggtcgagggcgcgcagcacgaggtgatgatggaaggg
gctgaaacacgccgcaccatttttgacaagatgacgcggctgtttgaccaatacgccgac
tag

DBGET integrated database retrieval system