KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c09410Help
Entry
PGA2_c09410       CDS       T02193                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase MurE (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pgl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pgl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1034877..1036361
Genome map
AA seq 494 aa AA seqDB search
MSTIENRPLSQLGLTARGGVDPMIRGIAVDSRKVVEGGLFAALPGSQVHGAKFTPAALGN
GAAAILTDAAGAQIVAELLRESTVALVVVEDPRQALAYAAALWFGAQPETMVAVTGTNGK
TSVASFVRQIWVELGHQAVNLGTTGVEGSWSHPLNHTTPEPVTLHGALAQAAAAGVTHAA
MEASSHGLEQRRLDGVHLAAAGFTNFTQDHLDYHETFEAYFTAKAGLFRRVLPDDGVAVI
NMDDPRGEQMRAVAAARGQEVISVGRGLGDLSLVGARYDASGQDMRFTWHDKPYQARLNL
IGGFQAENILLACGLVIASGEDPQAVFDTLPHLQTVRGRMQLAATRENGATVFVDYAHTP
DAVATAIKALRPHVLGRLVAIVGAGGDRDAAKRPLMGQAAQNNADLVIVTDDNPRSEDPA
VIRAAVKGGAPDAMEVGDRAEAILRGVDALGAGDALLICGKGHETGQIVGSDVLPFDDVE
QASMAVAVLDGRLV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattgaaaaccgtcctctcagccagttggggctgaccgcgcgtggcggtgtc
gatccgatgatccggggcattgccgtggacagccgcaaggtggtcgaaggcgggctgttt
gcagcccttcccggcagtcaggtgcatggggcgaaattcaccccggccgcgcttggcaac
ggggcggcggcgatcctgaccgatgcggccggggcgcagatcgtggcggagctgctgcgc
gagtcgactgtggctctggtggttgtcgaagacccgcgtcaggcgctggcctatgccgcg
gccctgtggttcggcgcgcagccggaaaccatggtggcggtcaccggcaccaatgggaaa
acttcggtggccagctttgtacgtcagatctgggtcgagctgggccatcaggcggtgaac
ctcggcaccactggcgttgaaggcagctggagccacccgctcaatcacaccacaccagaa
cctgtcaccctgcatggtgcgctggcgcaggcggcggctgcgggtgtcacccacgcggcg
atggaggcctcttcgcatgggctggagcagcggcgtctggacggtgtgcatctggcggcg
gcggggttcactaatttcacccaggaccacctcgactaccacgagacgtttgaggcgtat
tttaccgccaaggccggcctgttccgccgggtgctgccggatgatggcgtggccgtcatc
aacatggatgatccccgcggtgagcagatgcgggcggtcgccgcggcgcgcgggcaggag
gtgatttcggtcgggcgcggtctcggtgatctgagccttgtcggtgcgcgctatgatgcg
tccggtcaggacatgcgcttcacctggcacgacaaaccctatcaggcgcggctgaatttg
attggcgggtttcaggcggagaatatccttctggcctgcggtctggtgattgccagcggc
gaggacccgcaggcggtgtttgacacgctgccgcatttgcagaccgtacgcgggcggatg
cagctggcggccacgcgcgaaaatggcgcgacggtttttgtggattacgcccataccccc
gatgccgtggccaccgcgatcaaggcgttgcgcccgcatgtgctgggccggttggtggcc
attgtcggcgccggtggtgatcgcgatgccgccaaacgtccgctgatggggcaggcggcg
cagaataacgccgatctggtgatcgtcactgacgacaatccgcgcagcgaggatccggcg
gtgatccgcgccgccgtcaagggcggcgcgccggacgcgatggaagtcggcgaccgggcc
gaggcgattctgcgcggtgtggatgcgctgggggcgggcgatgccctgctgatctgcggc
aaggggcatgagacgggtcagatcgtcggcagtgatgttttgccctttgatgatgtggag
caggccagcatggcggtcgcggtgcttgacgggaggctggtatga

DBGET integrated database retrieval system