KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c10160Help
Entry
PGA2_c10160       CDS       T02193                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase AcsA (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pgl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgl00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pgl00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pgl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126637..1128187
Genome map
AA seq 516 aa AA seqDB search
MSGVGGHTLYPGLRTDGGWQFPSCLNMAAQALDHPDEQLALIDLTTGTRRDIRYGELRQM
VDAVAHDLMRRVQPGDRVGVLLSQSVDCAVAHLAIWKIGAISVPLFKLFQHDALASRIGD
AGLELVLTDGGGAAQLGALAQPLLVADILSASAGQSDHLLPYAETTPETPAVLIYTSGTT
GSAKGALHGHRVLSGHLPGVAISHDHLGQPGDCLWTPADWAWIGGLFDVLMPGLALGVPV
VAARLDKFTPEVCADIIRQGDVRNVFFPPTALRLLKAAGRGLDGLRSVASGGEPLGAEML
AWGQRHLGVTINEFYGQTECNMTVSSCVADFPVRPGCIGRPVPGCTVEVLDDTGTPTKDE
GDVAVRRGAASMMLEYWNRPDATAEKFHDDWLITGDRGIWEGDYLRFVGREDDVITSAGY
RIGPAEIEDCLMTHPAVATVGVVGKPDELRTEIVKAYVVLKPGHSPSEKDLQDYVKSRLA
KYSYPREVAFLDALPMTVTGKVIRKELKAQAAREVQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtgggtggacatacattgtatccgggattgcggacggatggcggatggcag
tttccgtcctgcctgaacatggcggcgcaggcgctggaccatccggacgaacaactggcc
ctcattgatctgaccaccggcacgcggcgcgatatccgctatggtgagctgcggcagatg
gtcgatgcggtggcgcacgatctgatgcggcgggttcagcccggtgaccgtgttggtgta
ctgctcagccaatctgtcgactgcgccgtagcacatcttgcgatctggaaaatcggtgcc
atttccgtgccgttgttcaagctgtttcagcatgacgcgctggcctcccgcattggcgat
gcagggttggagctggtgctgactgatggcgggggcgcggcgcagctcggggcgctggcg
caaccgctgctggtggcggatatcctgtccgcaagcgcaggtcaaagcgaccacctcctg
ccttatgcggaaaccacgcctgagaccccggcagtgctcatctacacctccggcaccacg
ggcagcgccaagggcgcgctgcatggtcaccgggtgctctccggtcacctgcccggcgtg
gccatcagccatgatcatctgggccaaccgggcgattgcctgtggacccctgcggattgg
gcatggatcggcggcttgtttgacgtgctgatgccgggtctggcgctgggtgtgccggtc
gtggccgcgcggctggacaagtttacgccggaggtttgcgccgacatcattcgtcagggg
gatgtgcgcaatgtgttctttcctcccactgcgctgcgcttgctgaaggcggcggggcgg
gggctcgacggtctgcgctcggtagcgtctgggggagagcccctgggcgcagagatgctc
gcctggggccagcgtcacctgggcgtgaccatcaatgaattttacggccagaccgaatgc
aacatgacggtttcctcctgcgtcgctgattttccggtgcgcccgggctgcatcggcagg
ccggttccaggatgcacggttgaggtgctggacgacacaggcacccccaccaaagatgag
ggcgacgtcgccgtacgccggggtgctgcgtcgatgatgcttgaatactggaatcgcccc
gacgcgacggctgaaaaatttcatgacgactggctgatcaccggggatcgcggcatctgg
gagggggactatctgcgctttgtcgggcgtgaggatgatgtcatcacttccgccggctac
cgcatcggtccagctgagattgaggactgtctgatgacccatccggccgtggcaaccgtg
ggtgtggtgggcaaacccgatgaacttcgcaccgaaatcgtgaaggcctatgtggtgctg
aaacccggtcactcaccatccgagaaagatctgcaagactacgtcaaatcccgtttggca
aagtattcttacccacgcgaagtggcgttcctggacgcgctgccgatgacggtgaccggc
aaggtgatccgcaaggagctgaaggcacaggcggcgagggaggtacaatga

DBGET integrated database retrieval system