KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c10610Help
Entry
PGA2_c10610       CDS       T02193                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase Pcm (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1171738..1172385)
Genome map
AA seq 215 aa AA seqDB search
MSEPTAETKMQFLFALRSRGVTDAQVLDAMEQIDRGPFVRGLFSARAYEDMPLPIACGQT
ISQPSVVGLMTQALQISPRDTVLEVGTGSGYQAAILSKLARRVYTVDRHARLVREARQIF
DQLHLSNITSLVGDGSHGLPEQAPFDRIIVTAAAEDPPGPLLAQLKTGGIMVVPVGQSDT
VQTLIRVQKTASGLEYDELRPVRFVPLLEGIGKDT
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgactgctgaaaccaagatgcagtttctgtttgccctgcgttcgcgcggg
gtgacggatgcgcaggtactggacgcgatggagcagatcgatcgcggcccctttgtgcgg
gggttgttctcggcgcgcgcctatgaggacatgccgctgccgatagcctgcggccagacc
atttcgcagccttcggtcgtcgggcttatgacccaggctttgcagatttcgccccgcgac
accgttctggaagtgggcaccgggtcgggttatcaggctgcgatcctgagcaagctggcg
cggcgggtctataccgtggaccgccatgcccggctggtgcgggaggcgcggcagatcttt
gaccagttgcatctgtccaatatcacctcgctggtgggagacggcagtcacgggttgccg
gaacaggctccctttgatcgaatcatcgtgaccgctgcggccgaggatccgcccggccca
ctcttggcgcagctgaagaccggcggtatcatggttgtgcccgtggggcagtcggacacc
gtacagaccctgatccgtgttcaaaaaaccgccagcggtctcgaatacgacgaattgcgc
ccggtgcgttttgttcccctgcttgaggggatcggcaaagacacgtaa

DBGET integrated database retrieval system