KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c11000Help
Entry
PGA2_c11000       CDS       T02193                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PGA2_c11000
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PGA2_c11000
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PGA2_c11000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1212926..1214032
Genome map
AA seq 368 aa AA seqDB search
MSFTIRQTAASLPHPTMAPPATLVYQRPSTKRIAMRYGATILDAEGLRLSAEEKAFFAQA
NPFGFILFARNIDSAEQTRALCNDLREAVGRDCLITVDQEGGRVQRLRPPLARQWQPALD
HASVAGAGATRAMYLRARLIADELRDLGIDSNCAPLADVAGEGTHPFLKNRCYGTDLTTV
VTRARATAEGLLDGGVVPVVKHIPGHGRASMDSHHDLPRITASLADLAREDFAAFAALND
LPMGMTAHLVYETLDSEPATLSPRVMQMIRSDIGFDGLIMSDDISMKALNGAPADIARDT
IAAGCDVVLFCNAPLDDRAAVAEAAGEMTDAAQARAERAEAARRTPAALDIPTAEAELSA
LMGGQVYG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgtttaccatccggcaaactgctgccagtttgccccatccgaccatggcgccgccc
gcgacactggtgtatcagcgccccagcacaaagaggatcgctatgcgttacggagccacc
atattagatgctgaaggtctgcgtctcagcgctgaggaaaaggcattctttgcccaggcc
aacccctttggctttatcctgtttgcccgcaatatcgacagtgccgaacagacccgtgcg
ctttgcaatgacctgcgcgaggcggtgggacgtgactgtctgatcaccgtcgaccaggag
ggcggccgggtgcagcgtctgcgcccgccactggcgcgccaatggcaaccagcgctggat
cacgcgtctgttgcgggggcaggtgcaacccgcgccatgtatctgcgcgcgcggctgatt
gcggatgaattgcgcgatctcggcatcgacagcaactgcgcgccgctggcggatgtggcg
ggcgaggggacgcatcccttcctcaaaaaccgctgctatggcaccgatctgaccaccgtc
gtcacccgcgcccgcgccacggctgaggggctgctggatggcggcgttgtaccggtggtg
aaacacatccccggccatggtcgcgccagcatggatagccaccatgatctcccccggatc
accgcctctctcgccgatctggcgcgggaggatttcgccgcttttgccgcgctgaacgat
ctgccgatggggatgacagcccatctggtatacgagacactcgacagcgaacccgccact
ttgtcacctcgtgtgatgcagatgatccgttcggacatcggctttgacgggctgatcatg
agcgacgatatttcgatgaaggcgctgaacggcgcccctgcagatattgcccgcgacacc
atcgcggccggctgcgatgtcgtcctgttctgtaacgccccgctggacgaccgcgccgcc
gtggcggaggccgctggcgagatgaccgacgccgcacaggcacgcgccgagcgcgccgaa
gccgcccgccgcacgcccgccgcgcttgacatacccacggccgaggccgaactatcagcc
ctcatgggcggacaggtatatggctga

DBGET integrated database retrieval system