KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c11940Help
Entry
PGA2_c11940       CDS       T02193                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PGA2_c11940 (deoA)
Enzymes [BR:pgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PGA2_c11940 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1320046..1321356
Genome map
AA seq 436 aa AA seqDB search
MDARAIIASLRRGDTPSDADLRWFAEGLANGTVSDAQAGAFAMAVCLQGLGVEARRALTL
AMRDSGDVLCWDLDGPVLDKHSTGGVGDCVSLLLAPALAECGAYVPMISGRGLGHTGGTL
DKMEAIPGVSIQVSEQDLVAMMQGVGCAIVGATAQIAPADKRLYAIRDVTATVDSLDLIT
ASILSKKLAASTDALVLDVKIGSGAFMKTLEEAEALARSLTETANAAGCRTSALITDMNQ
PLAPALGNALEVAEVMRVLTGVSGQGGALAELTAEQGGVLLAHGGLAADAEAGAAMIRKA
IASGAVAERFARMVAAMGGSSDFAETWQTILPTAPVQRRIKVEQTGYVSAIDGEALGLAV
VQLGGGRMIESDVVDPAVGLSELTPLGRKLSVGDQLGIVHAADEAAADVAETRLRAAYQL
SDAAPDLPPLIYKRIS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacgcgcaatcattgccagcctgcgccggggagacaccccgagcgacgcagat
ttgcgctggttcgctgaaggactggccaatgggacggtgtccgatgcccaggccggtgcc
tttgccatggcggtctgtctgcagggattgggcgtggaggcccgccgggcgctcacactc
gcgatgcgggacagcggcgatgtgctgtgctgggatctggacggaccggtgcttgataag
cattccaccggcggcgttggcgattgtgtgtcgctgttactggcaccggccttggcggaa
tgcggggcctatgttccgatgatctcggggcgggggctgggtcataccggcggcacgctc
gacaagatggaagctattccgggagtcagcatccaggtgtccgagcaggacctggtggcg
atgatgcagggcgtgggttgcgctatcgtcggtgcaacggcgcagatcgccccggcggac
aagcggctctatgcaatccgcgatgtgacggccaccgtggacagtctcgatctcatcact
gcgtcgatcctgtcgaagaaactggccgccagcaccgatgcgttggtgctggatgtaaag
atcggctccggtgccttcatgaaaacactggaagaggcggaggcgctggcgcgcagtctc
actgagacggcgaatgcggccgggtgccgaacctcggctttgatcaccgatatgaaccag
ccgctggcacccgctttgggcaatgcgctggaggtggcggaggtcatgcgggtgctgacc
ggcgtgtcagggcaaggtggggcattggcggagctgacggcggagcagggcggtgtgcta
ctggcccatggcgggctggctgcggatgccgaggccggggccgcgatgatccgcaaggcg
attgccagcggagccgtcgctgagcgcttcgcccggatggtggccgcgatgggagggtcg
agcgatttcgccgaaacctggcagaccatcctgccaaccgcaccggtgcaacgcaggatc
aaagtggagcagacgggctatgtcagcgcgattgatggcgaagcgctaggtctggcggtg
gttcagctgggcggcgggcgcatgatcgaaagcgatgtggtggatcctgcggtcgggctg
tcggaactgacgccgctgggccggaaactatctgtgggcgaccagctggggatcgttcat
gcggcggatgaggcggcagcggacgtggctgagacacgcctgcgcgcggcctatcaactg
tcggacgctgcgccggacttaccgcccctgatctacaaaaggatttcataa

DBGET integrated database retrieval system