KEGG   Phaeobacter inhibens 2.10: PGA2_c12900Help
Entry
PGA2_c12900       CDS       T02193                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase Acs
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00010  Glycolysis / Gluconeogenesis
pgl00620  Pyruvate metabolism
pgl00640  Propanoate metabolism
pgl00680  Methane metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_c12900 (acs)
   00620 Pyruvate metabolism
    PGA2_c12900 (acs)
   00640 Propanoate metabolism
    PGA2_c12900 (acs)
  Energy metabolism
   00680 Methane metabolism
    PGA2_c12900 (acs)
Enzymes [BR:pgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PGA2_c12900 (acs)
Lipid biosynthesis proteins [BR:pgl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PGA2_c12900 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFO87297
Position
complement(1418697..1420658)
Genome map
AA seq 653 aa AA seqDB search
MTQESDSKAYAPSEETVARAHVNAAQYDEMYAASMQDPEGFWRQQAERIDWIKPFTQVKD
VDFTLGNVSINWYADGTLNVAANCIDRHLDTRGDQTAIIWEPDSPDEAAQHISYKQLHTR
VCRMANVLETMGVRKGDRVVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALAARVN
GCDAKVLITADEAPRGGRKTPLKSNADAALLHTKDTVKCLVVKRTGGQTTWIDGRDYDYN
EMALEADDYSKPAEMNAEDPLFILYTSGSTGQPKGVVHTTGGYLTYAAMTHEITFDYHDG
DIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDASRFWQVCDKHKVTQFYTAP
TALRALMGQGNEWVEKCDLSSLRTLGTVGEPINPEAWNWYNDIVGKGKCPIVDTWWQTET
GGHLMTPLPGAHATKPGAAMKPFFGVAPVVLDPQSGAEITGNGVEGVLCIKDSWPGQMRT
VWGDHERFEKTYFSDYKGYYFTGDGCRRDEDGDYWITGRVDDVINVSGHRMGTAEVESAL
VAHAAVAEAAVVGYPHEIKGQGIYCYVTLMNDREPSDELVKELRTWVRTEIGPIASPDVI
QWAPGLPKTRSGKIMRRILRKIAENDFGSLGDTSTLADPSVVDDLIANRADKG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggagagcgacagcaaagcctatgcgccgtcggaggagacggttgcgcgtgcc
catgttaacgccgcacaatatgatgagatgtacgccgcttctatgcaggatccagagggt
ttctggcgtcagcaggcggagcggatcgactggatcaaacccttcacccaagtgaaggac
gtggacttcacgctcggtaatgtctcgatcaactggtacgcagacggcacgctgaatgtc
gctgccaactgcatcgaccgccaccttgacacccgcggcgatcagacggcgatcatctgg
gagcccgacagccccgatgaggctgcacaacacatttcttacaagcagctccacacccgc
gtctgccgtatggccaacgtgctggagacgatgggcgtgcgcaaaggggatcgcgtggtg
atctacctgccgatgatccccgaagccgcctatgccatgctggcctgcgcccgtatcggc
gcaattcactccattgtcttcgccggtttctcgccagatgccctggcggcgcgggtcaat
ggctgcgatgccaaggtcctcatcaccgcggatgaggccccccgtggtggccgcaagacc
cctctgaaatccaacgccgacgccgcgctcttgcacaccaaggacactgtgaaatgcttg
gtggtcaaacgcaccggcgggcagaccacgtggatcgacgggcgcgactatgactacaac
gaaatggcgttggaggcggacgactactccaaacccgcagaaatgaacgccgaggacccg
ctattcatcctctacacctccggctccaccggccagcccaagggggttgtacacaccacc
ggcggctacctgacctatgccgcgatgacgcatgagatcacctttgattatcatgacggc
gacatctactggtgtacggcggatgtgggctgggtaaccggccacagctatatcgtctat
gggccgctggccaatggtgccaccacgctgatgttcgaaggcgtgccaacctacccggat
gccagccggttctggcaggtctgcgacaagcataaggtgacgcagttctacaccgccccc
actgcactgcgcgccctgatgggtcagggcaacgaatgggtcgaaaaatgcgatctgtcc
tccctgcgcacccttggcaccgtgggcgagccgatcaatcccgaagcctggaactggtac
aatgatatcgtcggcaaaggaaaatgtcctattgtcgacacgtggtggcagaccgaaacc
ggtggtcacctgatgacccccctgcccggtgcccatgcaaccaaacccggtgcggcgatg
aagcccttctttggcgtggctcccgtggttctggacccgcaatccggcgcggaaatcacc
ggtaacggcgtcgaaggtgtgctctgcatcaaggacagctggcccggccagatgcgcacc
gtctggggcgaccatgagcggttcgagaagacgtatttctcggactacaaaggctactac
ttcaccggtgatggctgccgtcgcgacgaggacggcgactattggatcacgggccgcgtc
gatgacgtgatcaatgtctccggtcaccgcatgggcacagccgaggtcgaaagcgccctt
gtggctcacgccgccgtcgcggaggccgctgtggtcggctacccgcatgagatcaagggc
cagggcatttattgctatgtcaccctgatgaacgaccgcgaaccgtcggatgagctggtg
aaggagctgcgcacctgggtccggaccgagatcggcccgattgcctctcctgatgtgatc
caatgggcgccgggcctgccgaaaacccgctccggcaagattatgcgccgcattctgcgc
aagattgcggagaatgattttggcagccttggcgacacctcaaccctcgccgatccgtcg
gtggtggatgatctgatcgcaaaccgagcagataaaggatga

DBGET integrated database retrieval system