KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c13900Help
Entry
PGA2_c13900       CDS       T02193                                 

Gene name
xylA
Definition
xylose isomerase XylA (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PGA2_c13900 (xylA)
   00051 Fructose and mannose metabolism
    PGA2_c13900 (xylA)
Enzymes [BR:pgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PGA2_c13900 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1528945..1530249
Genome map
AA seq 434 aa AA seqDB search
MAGYFDDIAAITYNPESDGLAYRHYNPDEIVMGKRMEDHLRFAVCYWHNFVWEGNDPFGG
QTFQRPWFPADTMDLAHMKADAAFDMFRILGVPYYCFHDHDIRPEGDSLAESHRRLNQIG
DVLEQKMADGGPKLLWGTANMFSNRRYMSGASTNPDPDVFAYCASTVRACMDLTHRLNGE
NYVLWGGREGYETLLNTDLSRELEQMGRFLSMVVDYKHKIGFKGAILIEPKPQEPTKHQY
DYDVATVYGFLKRFGLEEEVKVNIEQGHAILAGHSFEHEIAMANALGIFGSIDMNRNDYQ
SGWDTDQFPNNVPEVALAYYEILRGGGLKTGGTNFDAKLRRQSLDAEDLIAAHVGAMDVC
ARGLRAAAAMLESDSLEAKRRDRYAGWTTAEAQAYLAEGATLEAIADQAEAKALNPQPVS
GRQEQLEALVNRFV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggctggctatttcgacgacatcgcagcaatcacctacaaccccgagagcgacgggctg
gcctatcgccactacaacccggacgaaattgtgatgggcaaacggatggaggaccacctg
cgctttgccgtttgctactggcataatttcgtgtgggaggggaacgacccctttggcggc
cagacgtttcagcgtccgtggttccccgctgacaccatggatctggcgcatatgaaggcg
gatgcggcctttgatatgttccgcattcttggcgtgccttactactgtttccatgaccat
gatatccggccagagggggacagccttgccgaaagccacagacgcctgaaccagatcggc
gatgtgctggaacagaaaatggcagacggtggtccgaaacttctgtgggggacggccaat
atgttctccaaccgccgctatatgtccggtgccagcaccaaccccgatccggatgtcttc
gcctattgcgcctccaccgtgcgggcctgcatggatctgacccatcgtctcaacggcgag
aattatgtcctttggggcggacgtgaggggtatgaaaccctgctcaacaccgatctgtcg
cgggagctggagcagatgggccgcttcctgtcgatggtggtcgattacaaacacaagatc
ggcttcaaaggggccatcctgattgagccgaagccgcaggagccgaccaaacaccaatat
gactacgacgtggccactgtttacggcttcctcaaacgctttggtcttgaggaggaggtg
aaggtcaatatcgaacagggccatgcgatccttgccggtcacagcttcgaacatgagatc
gccatggccaatgcgctggggatctttggctccatcgacatgaaccgcaatgactatcag
tccggttgggataccgatcagtttcccaataatgtgccggaggtggcgctggcctattac
gaaatcctgcgcgggggtgggctgaagactggcggtaccaatttcgacgccaaactgcgc
cgccagtcgctggatgccgaggatctgattgccgcccatgtgggcgcaatggatgtctgc
gcacgggggctgcgcgccgcagccgccatgttggagagcgatagcctggaggcaaagcgc
cgcgaccgttacgccggttggaccactgccgaggcgcaggcctatctggccgagggggcc
acgctggaggctatcgccgatcaggccgaggccaaggcgctcaatccgcagccggtttcc
ggccgtcaggaacagctggaggcgctggtcaaccgcttcgtctga

DBGET integrated database retrieval system