KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c16080Help
Entry
PGA2_c16080       CDS       T02193                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PGA2_c16080
Enzymes [BR:pgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PGA2_c16080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1773162..1773833
Genome map
AA seq 223 aa AA seqDB search
MTKPAPDDSDTLRQSIIDACLEMNRSGINQGTSGNISLRIAGGEMLITPSGIPYEAMTPD
MIVRMPVVGSPDPNEGQPAPSSEWQFHQALLADKPEAMAVVHAHPVNCCALAVNHMPIPA
CHYMVAAFGGHDVPLAEYALFGTTELSAHVVAAMADREGCLMANHGAICTGDTLARAMWR
MAELEHLAATYIRARSIGTPRLLSPTQMDEALAAFASYGLKRD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacccgccccggatgacagcgacacactgcgccagtcgatcattgatgcctgc
ctggagatgaaccggagtggcatcaatcagggcacctcaggcaatatctcgctgcggatc
gccgggggggagatgctgatcaccccatccggcatcccctacgaggcgatgaccccggac
atgattgtccggatgcccgtggtcggcagcccagatccaaatgaggggcagcctgccccc
tcttctgagtggcaatttcatcaggcactgctcgcagacaagccagaggcgatggccgtc
gtccatgcccacccggtgaactgctgtgccctcgctgtgaaccacatgcccatcccggcc
tgccactatatggttgcagcatttggcgggcatgacgtgccgctggcagaatatgcgctg
ttcggcacgaccgaattatcagcccatgtggttgcggcaatggcggaccgcgaggggtgc
ctgatggcgaaccatggcgccatctgcacaggcgacacactggcgcgcgccatgtggcgg
atggccgagctggagcatttggcggcaacttatattcgcgcgcgcagcattggcacgcca
aggctgcttagcccgacgcagatggacgaggcgctggcggcgtttgcgagctatggcttg
aaacgggattga

DBGET integrated database retrieval system