KEGG   Phaeobacter inhibens 2.10: PGA2_c17370Help
Entry
PGA2_c17370       CDS       T02193                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00010  Glycolysis / Gluconeogenesis
pgl00020  Citrate cycle (TCA cycle)
pgl00620  Pyruvate metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
Module
pgl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_c17370 (pdhC)
   00020 Citrate cycle (TCA cycle)
    PGA2_c17370 (pdhC)
   00620 Pyruvate metabolism
    PGA2_c17370 (pdhC)
Enzymes [BR:pgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PGA2_c17370 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFO87734
Position
1927152..1928486
Genome map
AA seq 444 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDTVASGDLLAEIETDKATMEFEAVDEGVIGKIL
IPEGSEGVKVNSPIAVLLEEGESADDIGTTPSAPAAAADEAAPVAPEEAAPASFPAPAEA
PAAATPAPAAPQGADGNRIFASPLARRIAADKGLDLAQLNGSGPRGRIVKADVENAKPQV
AAAPAAAAPATAAAPAAAVSTGPSTDQVARMYEGRTYEEVKLDGMRKTIAARLTEAKQTV
PHFYLRRDIQLDALLKFRGELNKQLEARGVKLSVNDFIIKACALALQAVPDANAVWAGDR
VLKMEASDVAVAVAIEGGLFTPVLQNSDTKSLSTLSTEMKDLAKRARDRKLAPHEYQGGS
FAISNLGMFGIDNFDAIVNPPHAGILAVGAGVKKPVVGADGELAVATVMSVTMSVDHRVI
DGALGAELLNAIKDNLENPMMMLA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgaaatcctgatgcccgccctctctcccacgatggaggaaggcacgcttgcc
aaatggctcgtgaaggaaggcgacaccgtcgcctccggcgaccttctggcggaaatcgaa
accgacaaggcgacgatggaatttgaggccgtcgacgaaggggtgatcggcaagatcctg
atccccgaaggcagcgaaggtgtgaaggtcaacagccccatcgccgtgctgctggaagag
ggcgaaagtgccgacgacatcggcaccaccccgtctgcccccgcagccgcggcagacgag
gccgcccctgtggcgcccgaggaagccgccccggcctctttcccagctccggcagaggcc
cccgctgcggcaacacccgcgcccgcagccccgcagggcgccgatggcaaccgcatcttt
gcatcgcctctggcgcgccgtatcgcggctgataaggggttggatctggcccagctgaac
ggctccggcccccgtggccgcatcgtgaaggccgacgtggaaaacgccaaaccgcaggtc
gccgccgccccggcagcagccgctccggcaaccgccgcagcccctgccgcagctgtctcc
actggtccctctaccgatcaggtcgcccgcatgtacgaaggccgcacctatgaggaggtc
aaactggacggcatgcgcaagaccatcgccgcccgcctcaccgaagccaagcagaccgtg
ccgcatttctacctgcgccgcgacatccagctggatgcactgctgaagttccgcggcgag
ctgaacaaacagctggaggcccgtggcgtcaaactctcggtcaatgacttcatcatcaag
gcctgtgccctggcgctgcaggccgtgccggacgcaaacgccgtctgggccggggaccgc
gtgctgaagatggaggcctccgatgtggcggtcgccgtcgcgattgagggcggcctgttc
acgcccgtcctgcagaacagcgataccaaatcgctctcgaccctgtcgacggagatgaaa
gacctcgccaaacgcgcccgcgaccgcaaacttgcgccgcatgaatatcagggtggcagc
tttgcgatctccaacctcggcatgttcggcatcgacaatttcgacgccatcgtgaacccg
ccgcacgcaggcatcctcgccgtgggcgcaggggtcaagaaaccggttgtcggtgcagac
ggcgaactggccgtggccaccgtgatgtcggtgaccatgtccgtcgaccaccgcgtcatc
gacggcgcacttggcgcagaactgctgaacgcgatcaaggacaacctcgaaaacccgatg
atgatgctggcctga

DBGET integrated database retrieval system