KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c19490Help
Entry
PGA2_c19490       CDS       T02193                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGA2_c19490 (tpiA)
   01230 Biosynthesis of amino acids
    PGA2_c19490 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_c19490 (tpiA)
   00051 Fructose and mannose metabolism
    PGA2_c19490 (tpiA)
   00562 Inositol phosphate metabolism
    PGA2_c19490 (tpiA)
Enzymes [BR:pgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PGA2_c19490 (tpiA)
Exosome [BR:pgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PGA2_c19490 (tpiA)
  Exosomal proteins of bladder cancer cells
   PGA2_c19490 (tpiA)
  Exosomal proteins of melanoma cells
   PGA2_c19490 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2158801..2159553
Genome map
AA seq 250 aa AA seqDB search
MRRKLAAGNWKMNGTASALTELGNLAYSCKSAKAEVLICPPATLLYRAANVCVDSKVSIG
AQDCHSATYGAHTGDLSAEMLHDAGATAVILGHSERRADHGETDETVRAKAKTAIAAGLT
AIICVGETLSDREAGKTLDVVRAQLAGSLPDDTSGTTVVVAYEPVWAIGTGKVPTVEQIA
EVHNDLRASLVKRFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALVGGASLKAADFA
PIVAALDASA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcggaaactggccgcaggcaattggaaaatgaacggcaccgcaagtgcgctgaca
gagctgggcaatcttgcctatagctgcaaatccgccaaggccgaggtgctgatctgcccg
cctgcaaccctgctctaccgcgcggccaatgtctgcgtcgacagcaaggtgagcattggc
gcccaggattgccacagcgccacctatggcgcccataccggcgatctcagcgcggaaatg
ctgcatgacgcgggcgccaccgccgtgatcctcggccattccgaacgccgggccgaccac
ggtgagacggatgaaacggtccgggccaaggccaagaccgccatcgctgcggggctgacc
gccatcatctgcgtgggcgaaaccctgagcgaccgcgaggcgggcaaaacacttgatgtg
gtccgggcgcaattggcaggctccctccccgatgacaccagcggcacaaccgtggtggtg
gcctacgaaccggtctgggcgatcggcacaggcaaggtgcccacggtcgaacagattgcc
gaagtgcacaacgacctgcgcgccagcctcgtgaaacgcttcggcggcgagaccgcaaac
gccatccgactgctctatggcggatctgtcaaagccagcaatgccaaggaaatcttcgca
gtggcccatgtcgacggcgccctggttggcggcgccagcctcaaggctgcggatttcgcc
cccatcgtcgcggctctcgacgctagcgcataa

DBGET integrated database retrieval system