KEGG   Phaeobacter inhibens 2.10: PGA2_c19490Help
Entry
PGA2_c19490       CDS       T02193                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00010  Glycolysis / Gluconeogenesis
pgl00051  Fructose and mannose metabolism
pgl00562  Inositol phosphate metabolism
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
pgl01230  Biosynthesis of amino acids
Module
pgl_M00002  Glycolysis, core module involving three-carbon compounds
pgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_c19490 (tpiA)
   00051 Fructose and mannose metabolism
    PGA2_c19490 (tpiA)
   00562 Inositol phosphate metabolism
    PGA2_c19490 (tpiA)
Enzymes [BR:pgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PGA2_c19490 (tpiA)
Exosome [BR:pgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PGA2_c19490 (tpiA)
  Exosomal proteins of bladder cancer cells
   PGA2_c19490 (tpiA)
  Exosomal proteins of melanoma cells
   PGA2_c19490 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFO87940
Position
2158801..2159553
Genome map
AA seq 250 aa AA seqDB search
MRRKLAAGNWKMNGTASALTELGNLAYSCKSAKAEVLICPPATLLYRAANVCVDSKVSIG
AQDCHSATYGAHTGDLSAEMLHDAGATAVILGHSERRADHGETDETVRAKAKTAIAAGLT
AIICVGETLSDREAGKTLDVVRAQLAGSLPDDTSGTTVVVAYEPVWAIGTGKVPTVEQIA
EVHNDLRASLVKRFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALVGGASLKAADFA
PIVAALDASA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcggaaactggccgcaggcaattggaaaatgaacggcaccgcaagtgcgctgaca
gagctgggcaatcttgcctatagctgcaaatccgccaaggccgaggtgctgatctgcccg
cctgcaaccctgctctaccgcgcggccaatgtctgcgtcgacagcaaggtgagcattggc
gcccaggattgccacagcgccacctatggcgcccataccggcgatctcagcgcggaaatg
ctgcatgacgcgggcgccaccgccgtgatcctcggccattccgaacgccgggccgaccac
ggtgagacggatgaaacggtccgggccaaggccaagaccgccatcgctgcggggctgacc
gccatcatctgcgtgggcgaaaccctgagcgaccgcgaggcgggcaaaacacttgatgtg
gtccgggcgcaattggcaggctccctccccgatgacaccagcggcacaaccgtggtggtg
gcctacgaaccggtctgggcgatcggcacaggcaaggtgcccacggtcgaacagattgcc
gaagtgcacaacgacctgcgcgccagcctcgtgaaacgcttcggcggcgagaccgcaaac
gccatccgactgctctatggcggatctgtcaaagccagcaatgccaaggaaatcttcgca
gtggcccatgtcgacggcgccctggttggcggcgccagcctcaaggctgcggatttcgcc
cccatcgtcgcggctctcgacgctagcgcataa

DBGET integrated database retrieval system