KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c22050Help
Entry
PGA2_c22050       CDS       T02193                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Brite
Enzymes [BR:pgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PGA2_c22050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2443343..2443996)
Genome map
AA seq 217 aa AA seqDB search
MTDFAERRRMMVDTQIRPSDVTKFPIIEAMLAVPREAFVADAQREAAYADGNLDLGPGRV
LLEPRTLAKILDAIDVQPDELVLDVACGLGYSTAVIARVAQMVIGVEDDETMASEAQDQL
SAVGADNAIVHTGALDAGAAEHGPYDVMIIEGGVETVPEALLDQLKDGGRVAAIFMSGAL
GEVKVGYKSGGQISWRLSFNAGAPVLPGFEAAKEFAL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttcgccgaacgtcgccgcatgatggtcgacacgcagatccgcccgtcggat
gtcaccaaattcccgatcatcgaagccatgctggcggtgccgcgcgaagcctttgtggcg
gacgcgcagcgcgaggcggcttatgccgatggcaatctggatctcggccccggtcgcgtg
ctgcttgagccgcgcaccctggccaagatccttgatgcgattgatgtgcagccggacgag
ctggtgctcgatgtggcctgtggtctgggctattccaccgctgtgatcgcccgcgtcgcc
cagatggtgatcggggtcgaagacgacgagaccatggcctctgaggcgcaggatcagctg
tcggcagttggcgccgacaatgccattgtccacactggcgcgctggatgccggtgctgcg
gaacatggcccctatgatgtgatgatcattgaagggggcgtggaaaccgtgccggaggcg
ctgctggaccagctgaaggatggcggtcgcgtggccgcgatcttcatgtccggcgcattg
ggagaggtcaaagtcggctataagagcggcggccagatctcctggcggctgtcgttcaat
gccggtgctccggtgctgcccggttttgaggcggcaaaggaattcgctctctga

DBGET integrated database retrieval system