KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c22370Help
Entry
PGA2_c22370       CDS       T02193                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_c22370 (algC)
   00030 Pentose phosphate pathway
    PGA2_c22370 (algC)
   00051 Fructose and mannose metabolism
    PGA2_c22370 (algC)
   00052 Galactose metabolism
    PGA2_c22370 (algC)
   00500 Starch and sucrose metabolism
    PGA2_c22370 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA2_c22370 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PGA2_c22370 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGA2_c22370 (algC)
Enzymes [BR:pgl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PGA2_c22370 (algC)
    5.4.2.8  phosphomannomutase
     PGA2_c22370 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2473409..2474905
Genome map
AA seq 498 aa AA seqDB search
MTKPIPEVRPNTWSFLRDPMITPTGFREYDARWKYPEEINLPGMTALGLGLGTQMHKRGI
PPVIAVANDYRDYSVSIKHALIIGLMQAGIEVRDIGPALSPMAYFAQFHLDVPAVAMVTA
SHNPNGWTGVKMGFERPLTHGPDEMGELRDIVLNGEGVARPGGSYQFVDGVKEAYLDDLV
GDFKMSRPLKVVCATGNGTASAFAPELFERMGVEVVDSHNALDYTFPHYNPNPEAMEMLH
DMSASVKASGADMALGFDGDGDRCGVVDDEGEEIFADKVGVIMARDLSKLYPNSTFVADV
KSTGLFASDPELKANGVTADYWKTGHSHMKRRVKEIGALAGFEKSGHYFLAEPVGRGYDC
GMRVAVEICKLMDRNPDKSMSDLRKALPKTWATPTMSPYCADTEKYTVLERLVAKLVAKA
KAGETLADRPIKEVVTVNGARVILDNGSWGLVRASSNTPNLVVVCESSESEAELRQIFAE
IDAVIRTEPLVGDYDQTF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacccatccccgaggtgcgcccgaacacctggagttttctgcgcgatccgatg
atcacgcccaccggttttcgcgaatatgacgcgcgctggaaatatcctgaggaaatcaac
ctgcccggcatgaccgcgctggggctgggtctgggcacccagatgcacaagcgtggcatc
ccgccggtgattgcagtggcgaatgattaccgcgactactccgtgtccatcaaacatgcg
ctgatcatcggcctgatgcaggcaggtatcgaagtgcgcgatatcggcccggccctgtcg
cctatggcctatttcgcccagttccatctggatgtgcctgccgtcgccatggtcaccgcc
agccacaaccccaacggctggaccggggtcaagatgggctttgaacgcccgctgacccac
ggcccggacgaaatgggtgagctgcgggacattgtcctgaatggtgagggtgtcgcccgt
cccggcggttcctatcagttcgtggatggtgtgaaagaggcctatctcgatgatctggtc
ggcgatttcaaaatgtcccgcccgctgaaggtggtctgcgccaccggcaatggcaccgcc
tcagcctttgcaccggagctgttcgaacggatgggggttgaggtggtcgatagccacaat
gcgctggactataccttcccacactacaacccgaaccccgaagccatggaaatgctgcac
gatatgtccgccagcgtgaaggcctctggcgccgatatggcgcttggctttgatggcgac
ggcgatcgttgcggcgtggtggatgatgagggcgaagagatctttgccgataaggttggc
gtcatcatggcgcgggatctgagcaagctttacccgaattcgacctttgtcgcggatgtg
aaatccaccgggctgtttgcctctgatcccgagctgaaggccaatggcgtgacggcggac
tattggaaaaccggtcacagccatatgaaacggcgggtgaaggagatcggcgcgctggcg
ggatttgaaaagtccggccactatttcctcgctgaacctgtgggccggggctatgactgc
ggcatgcgggttgcggtcgagatctgcaagctgatggaccgcaacccggacaagagcatg
tccgacctgaggaaagcgctgcccaagacctgggcgaccccaaccatgtcgccctattgc
gccgacaccgagaaatataccgtgctggagcgcctggtggcaaagctggtcgccaaggct
aaggcgggtgagacgctggcagaccgccccatcaaggaggtcgtcaccgtgaacggggcg
cgtgtgatccttgataacgggtcctgggggttggtgcgggcatcgtctaatacgcccaac
ctcgtggtggtctgcgaaagcagcgagagcgaggcggaactgcgccagatctttgccgag
attgacgcagtgatccgcaccgaaccgctggtcggtgactatgatcagaccttttga

DBGET integrated database retrieval system