KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c23290Help
Entry
PGA2_c23290       CDS       T02193                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pgl00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pgl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2567485..2567850)
Genome map
AA seq 121 aa AA seqDB search
MRNILLAVFLATGSGQAAAADGDAAAGEKVFKKCAACHAVEEGKKKVGPTMFGIWGRPAG
AVEGYKYSSAMQEAEFSWDEEQLTGFLAAPKKHLPGTKMAFPGLKKEQQISDLLAYLKTL
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatattctactggccgttttcctagcaactggcagtggccaagccgcagcggca
gatggtgatgctgccgcaggtgaaaaagtgttcaagaaatgtgccgcctgccatgcagtg
gaggagggtaagaagaaagtcgggccgacaatgtttggtatctggggtaggcccgcgggg
gcggtcgaagggtacaaatactcctctgctatgcaggaggcggaattctcttgggacgag
gaacagctgacgggattcctagcggcaccaaagaaacatcttccaggcacaaagatggcc
ttcccgggattgaaaaaggaacagcagatcagcgacctgttggcatacctaaaaacactg
aattag

DBGET integrated database retrieval system