KEGG   Phaeobacter inhibens 2.10: PGA2_c23290Help
Entry
PGA2_c23290       CDS       T02193                                 

Definition
(GenBank) putative cytochrome c
  KO
K08738  cytochrome c
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA2_c23290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AFO88318
Position
complement(2567485..2567850)
Genome map
AA seq 121 aa AA seqDB search
MRNILLAVFLATGSGQAAAADGDAAAGEKVFKKCAACHAVEEGKKKVGPTMFGIWGRPAG
AVEGYKYSSAMQEAEFSWDEEQLTGFLAAPKKHLPGTKMAFPGLKKEQQISDLLAYLKTL
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatattctactggccgttttcctagcaactggcagtggccaagccgcagcggca
gatggtgatgctgccgcaggtgaaaaagtgttcaagaaatgtgccgcctgccatgcagtg
gaggagggtaagaagaaagtcgggccgacaatgtttggtatctggggtaggcccgcgggg
gcggtcgaagggtacaaatactcctctgctatgcaggaggcggaattctcttgggacgag
gaacagctgacgggattcctagcggcaccaaagaaacatcttccaggcacaaagatggcc
ttcccgggattgaaaaaggaacagcagatcagcgacctgttggcatacctaaaaacactg
aattag

DBGET integrated database retrieval system