KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c24400Help
Entry
PGA2_c24400       CDS       T02193                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PGA2_c24400
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGA2_c24400
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PGA2_c24400
Lipid biosynthesis proteins [BR:pgl01004]
 Fatty acid synthase
  Component type
   PGA2_c24400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2689820..2690461)
Genome map
AA seq 213 aa AA seqDB search
MRKMIAGLIFILTAAIAQAEPVRIAALGDSLVQGYGLPQGQGWVPQLQRWLGEKGAEVRL
INAGVSGDTTAGGAARIDWTLADGPDALIVALGGNDLLRGLAPSESRANLTRILEVAQAN
AVPVLLVGIQAPGNYGADFKAEFDAIFPDLARDYDTLLHADSLAGIRAATGGDIQAAGQY
LQEDGIHPNAEGVALNVAAIGPKVLELIELAKQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagatgatagcaggactgatttttatattaactgcggcgattgcgcaggcagag
ccggtgcgtattgctgcgcttggtgacagtctggtgcagggctatggcctgccgcaggga
cagggctgggtgccgcagctgcaacgctggctgggcgaaaagggggctgaggtgcggctg
atcaatgccggtgtctccggtgacacgaccgcaggcggcgccgcccggatcgactggacg
ctggccgacggaccggatgcgctgatcgtggctcttggtggcaatgacctgctgcgcggc
cttgcgccgtccgaaagccgcgccaatctcacccgcattctggaggtcgcacaggccaat
gcggttccggtgttgctggtcggcattcaggcgccgggcaactatggcgcggatttcaaa
gcggagttcgatgcgattttccccgatctcgcgcgggactatgacacgctgcttcacgcg
gacagcctcgctggtatccgggccgcaaccggtggtgatattcaggctgcggggcaatat
ctgcaggaggacgggatccaccccaatgccgaaggtgtggcattgaatgtggccgccatc
ggtccgaaggtgctggaactgatagagctggctaagcaatag

DBGET integrated database retrieval system