KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c28100Help
Entry
PGA2_c28100       CDS       T02193                                 

Gene name
cycM
Definition
cytochrome c-552
Orthology
K08738  
cytochrome c
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pgl00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pgl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3092129..3092632)
Genome map
AA seq 167 aa AA seqDB search
MFDTMTLTKATAGVCGAFLVFLLGKWAAEELYHTESHGEASYVIEVEEAGAEEVAEVVDF
GELMAAADVGKGAKVFKKCSACHKLEAGENATGPYLYGVVDRPIAAADGFGYSATLAGLG
GEWTAEELDAFLTKPSQYAPGTTMSFSGLKKQKDRVNLIAYLDSLDD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacacgatgacccttaccaaagcgaccgcaggcgtttgcggcgcgttcctcgtg
ttcctcttgggcaaatgggccgcagaggaactctatcacaccgaaagccacggcgaggct
tcttatgtgattgaagtggaagaggcaggtgcggaagaagttgctgaagtcgtagacttc
ggcgaactgatggccgcagcagatgttggcaaaggtgccaaggtcttcaagaaatgctcc
gcctgccacaaacttgaagccggtgaaaacgccaccggtccctatctatatggggtggtt
gatcgcccgatcgccgctgcggatggctttggatactctgccaccctggccggtcttggc
ggcgaatggaccgcagaggagttggacgccttcctgaccaaaccgtcacaatatgcgcct
ggtaccaccatgagctttagcgggctgaagaagcagaaggatcgggttaacctgatcgcc
tatctcgatagcctcgacgattga

DBGET integrated database retrieval system