KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c30540Help
Entry
PGA2_c30540       CDS       T02193                                 

Definition
guanidinobutyrase (EC:3.5.3.7 3.5.3.10)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PGA2_c30540
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PGA2_c30540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3320885..3321811)
Genome map
AA seq 308 aa AA seqDB search
MPRFAGLPTFMRLPHVTVSDPIIDQVQLGLVGVPWDAGTTNRPGPRHGPRQLRDLSTMIR
AGNPVTGINPFSMINCADLGDVAPNPVDIIDCMERISAFYADLKSRDIFALTVGGDHLVS
LPVLRGLASGAPVGLIQFDSHTDLFDSYFGGNKYTHGTPFRRAIEEGLVDPKRMVQIGIR
GTAYNTEDVEWGQAQGVRIIRIEEFFDRGVSDVMREVREIVGDQPTYCTYDIDFVDPAFA
PGTGTPEVGGPNSFQALQVVRELAGVQLVGADLVEVSPPFDTNGNTAWLGASILFEMLCV
SAGAISRR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccccggtttgccggtttgccgacctttatgcggctaccacatgtaacagtgtctgat
ccgatcattgatcaggtgcagctgggcttggttggcgtgccttgggatgccggaacaacc
aatcgtccgggtccgcgccatggtccgcgacagctgcgcgacctttcgaccatgatccgg
gccgggaacccggtgacaggcatcaatcctttttcgatgatcaattgcgcagaccttggt
gatgtcgcgcccaacccggtcgatatcatcgactgtatggagcggatcagcgctttctat
gcggatctgaaatctcgcgacatctttgcgctgactgtcggcggggatcacctcgtttca
ttacctgtcttgcgaggactggccagcggcgcgccagtggggctcattcagtttgatagt
catactgatctctttgacagctattttggtggaaacaaatatactcacggcacccctttt
cgtcgtgcaatcgaagaaggattggtcgatccgaagcggatggtgcagatcggcattcgg
ggcaccgcttacaacaccgaagatgtcgaatgggggcaggcacagggtgtgagaattatt
cgaattgaggagttttttgatcgcggtgtctcggacgtcatgcgtgaagtacgagagatt
gtcggtgatcagccaacctactgtacatacgatatcgattttgttgatccggctttcgcg
cctggcacgggaacacctgaggttggggggccgaacagttttcaggccctgcaggtggta
cgtgaacttgcaggcgtccagcttgtgggagccgatctggttgaggtgtcccctccgttt
gacacaaacggaaacaccgcgtggcttggggcgtcgatcctattcgagatgctctgtgtc
agtgccggtgcgatttcgcgacgatga

DBGET integrated database retrieval system