KEGG   Phaeobacter inhibens 2.10: PGA2_c31450Help
Entry
PGA2_c31450       CDS       T02193                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00071  Fatty acid degradation
pgl00072  Synthesis and degradation of ketone bodies
pgl00280  Valine, leucine and isoleucine degradation
pgl00310  Lysine degradation
pgl00362  Benzoate degradation
pgl00380  Tryptophan metabolism
pgl00620  Pyruvate metabolism
pgl00630  Glyoxylate and dicarboxylate metabolism
pgl00640  Propanoate metabolism
pgl00650  Butanoate metabolism
pgl00900  Terpenoid backbone biosynthesis
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
pgl01212  Fatty acid metabolism
pgl02020  Two-component system
Module
pgl_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGA2_c31450
   00630 Glyoxylate and dicarboxylate metabolism
    PGA2_c31450
   00640 Propanoate metabolism
    PGA2_c31450
   00650 Butanoate metabolism
    PGA2_c31450
  Lipid metabolism
   00071 Fatty acid degradation
    PGA2_c31450
   00072 Synthesis and degradation of ketone bodies
    PGA2_c31450
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGA2_c31450
   00310 Lysine degradation
    PGA2_c31450
   00380 Tryptophan metabolism
    PGA2_c31450
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGA2_c31450
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PGA2_c31450
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA2_c31450
Enzymes [BR:pgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PGA2_c31450
Exosome [BR:pgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGA2_c31450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFO89108
UniProt: I7EGA8
Position
complement(3416716..3417888)
Genome map
AA seq 390 aa AA seqDB search
MKTVVIAGAARTPMGGFQGMYDGVAAAELGGAAIRAALAGAGATTVDEVLMGCVLPAGQG
QAPARQAGFAAGLGEEVPATTLNKMCGSGMKAAMMAYDQIALGQAETMIAGGMESMTDAP
YLLPKMRNGARLGHGQVVDHMFLDGLEDAYDKGRLMGTFAEDCAETYQFTREAQDEYALT
SLSNALAAQESGAFDAEIAPVTVKTRKGETVTNADEQPKSARPDKIPTLKPAFRKDGTVT
AANASSISDGAAALVLASEDAAEAQGLTVRARIMGHASHAQAPGLFTTAPVPAAKKLMAQ
LGWTVSDVDLWEVNEAFAVVPMAFMHEMGLPRDKVNVNGGACALGHPIGASGARIMVTLL
NALEKRNLKRGIAAICIGGGEGTAIAIERM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgttgtgatcgcaggcgcggcccgcaccccgatgggcggatttcagggcatg
tacgacggcgtcgcagccgctgagctgggcggcgctgcaattcgcgcggcgcttgcgggg
gcaggggccaccactgtcgatgaagttctgatgggctgtgtgctgcccgcgggtcagggg
caggcgccagcgcggcaggcagggttcgcagctggcctgggcgaagaggtgccggcaacc
acgctgaacaagatgtgcggctcgggcatgaaggcggcgatgatggcctatgatcagatc
gcgttgggtcaggcggagactatgattgcgggtgggatggagagcatgacagatgcacca
tatctgctgccaaagatgcgcaatggggcacggctcggtcacgggcaggtggtcgatcat
atgtttttggacgggcttgaggatgcttatgacaaaggtcgcctgatgggcacctttgcc
gaggactgtgcggagacctatcagttcacgcgggaagcacaggatgaatacgcgctgaca
tcgctgtcaaatgcgctggcagcgcaggaaagcggtgcctttgatgccgagatcgcgccc
gtcaccgtcaaaacccgtaagggcgagacagtcactaacgcggatgagcagcccaaatca
gcacgccctgacaagattccgacactgaaaccggccttccgtaaggatggtaccgtcacc
gcagccaatgcctcgtcgatctcggatggcgccgccgcattggtgctggcctctgaagat
gccgcagaagcccagggtctgactgtacgcgcccgcatcatgggtcatgccagtcacgcc
caggcgccggggttattcacaacggctccggttccggcagccaaaaagctgatggcgcag
ctcggctggacggtcagcgatgtggacctttgggaggtgaacgaagcctttgccgtcgtg
ccaatggccttcatgcatgaaatggggctgccgcgtgacaaagtgaacgtcaacggtggc
gcctgtgctttgggccatccgatcggtgcctccggcgcgcgtatcatggtgacattgctg
aacgcactggagaaacgcaacctgaagcgcggcattgcagccatttgcatcggcggcggc
gagggcacggccatcgctattgagcgcatgtga

DBGET integrated database retrieval system