KEGG   Phaeobacter inhibens 2.10: PGA2_c32690Help
Entry
PGA2_c32690       CDS       T02193                                 

Gene name
celA
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase CelA
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00040  Pentose and glucuronate interconversions
pgl00052  Galactose metabolism
pgl00500  Starch and sucrose metabolism
pgl00520  Amino sugar and nucleotide sugar metabolism
pgl01100  Metabolic pathways
pgl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PGA2_c32690 (celA)
   00052 Galactose metabolism
    PGA2_c32690 (celA)
   00500 Starch and sucrose metabolism
    PGA2_c32690 (celA)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA2_c32690 (celA)
Enzymes [BR:pgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PGA2_c32690 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFO89230
UniProt: I7ETX7
Position
complement(3552007..3552900)
Genome map
AA seq 297 aa AA seqDB search
MRRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSR
GKGALEDYFDHSPMLEQELRKKGKDDLLDILKATNMDSGAIAYIRQHQALGLGHAVWCAR
RLIANEPFAVILPDDVIAAETPCLKQMVEAYEETGGNMVAAMEVPPEQTSSYGVLDVRDD
MGSVVSVNGMVEKPKAEEAPSNLAVIGRYILAPSVLRNLNKKKQGAGGEIQLTDAIAEDI
AADVPVYGYRFRGQRFDCGSKAGFLQATVAFALAREELRDDLMCYINQIAQVDKAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagaaaagtaacgaaggcaatttttccggtggccggtcttggaacgcggttcctg
ccagcgaccaaatctgttcccaaagaaatcatgacgctggtggatcgtccgctggtccaa
tacgccattgatgaggcgcgtgaggccgggatcaaggaattcatctttgtaacctcgcgc
ggcaaaggcgcgcttgaggactatttcgaccactcgcccatgctcgaacaggagctgcgc
aagaagggcaaggacgaccttctggatatcctgaaggcgaccaatatggattcgggcgcg
atcgcctatattcgtcagcatcaggcgctaggccttggccacgcggtctggtgcgcgcgc
cgtctgatcgccaacgaaccctttgccgtgattctgcccgacgacgtcatcgcggcggaa
acgccctgtctcaagcagatggtggaagcctatgaagaaaccggcggcaatatggttgcg
gccatggaggttccaccggagcagacatcatcctacggtgtgctggatgtgcgcgatgat
atgggatcggtggtgtctgtgaatggcatggttgagaagcccaaagctgaagaggcgcca
tctaatcttgcggtgattggccgctatattctggccccttctgtgctgcggaatttgaac
aagaagaaacagggtgctggcggtgaaatccaactgacggatgccattgcggaagacatt
gccgctgatgtgccggtttatggctaccggttccgtggtcagcgatttgactgcgggtcc
aaggcgggtttcctgcaggcgacggttgccttcgcgctggcgcgtgaggaactgcgtgat
gatctgatgtgctatatcaatcagattgcgcaggtcgacaaggcggcgcaataa

DBGET integrated database retrieval system