KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c33190Help
Entry
PGA2_c33190       CDS       T02193                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PGA2_c33190
Enzymes [BR:pgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PGA2_c33190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3605358..3606230)
Genome map
AA seq 290 aa AA seqDB search
MAIWNLGSINADMIYALPHMPTAGETLAATGLEQYLGGKGANMSVAAARAGSHVCHLGAV
GPEGAWAVTRLLEYGVDTRHIAQLDVPTGHAIIAVDPTGENQIILFPGANREISEDQIGA
ALSAASAGDILVMQNETNMQAETAQMGRDLGLKVAYAAAPFDAAAVQAVLPYLDYLFLNE
VEAEQLRAATGKMPEALGVADVIVTLGAKGARHYDTTAGTTHDVAAHSVVPVDTTGAGDT
FTGYVLSGLDRGLPMAQALAQANRAAALMVTRKGTADVIPDLKEVQDARF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctggaacctaggctcaatcaatgccgacatgatttatgcgctgcctcatatg
ccgactgcgggggaaaccctcgcggcgacggggctggagcagtatctgggcggcaaaggc
gccaatatgtcggttgcggctgcgcgtgccggtagccatgtttgtcatctgggcgccgtc
gggccggagggggcatgggccgttacgcgtctgttggaatacggtgtcgatacgcgtcac
atcgcccagttggatgtgcctaccggccacgccatcattgccgtcgaccccactggcgag
aaccagatcattctattccccggcgcaaaccgggagatcagcgaagaccagattggcgca
gcgctgtctgccgctagtgccggtgatatcctggtgatgcagaacgagaccaacatgcag
gccgagacagcccaaatggggcgtgatctggggttgaaggttgcctatgcggcagcaccg
tttgatgcagcggcggttcaggcggtcttgccctatctcgactatctgttcctgaatgag
gtggaggctgagcagttgcgcgctgcgacaggcaaaatgcctgaggcgctgggcgttgca
gatgtgattgtgacgttgggcgccaagggggcgcgccactacgacacgacggcgggaacc
actcatgacgtcgcggcgcattccgttgtcccggttgataccacaggggcgggtgacact
ttcactggctatgtgctgtctggtctggatcgtgggttgccaatggcgcaggcgctggca
caggccaatcgcgctgccgcgctgatggtgacacgtaagggcaccgcagatgtgatccca
gatttgaaagaggtgcaggacgcacgtttctga

DBGET integrated database retrieval system