KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c34600Help
Entry
PGA2_c34600       CDS       T02193                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pgl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3746810..3747967
Genome map
AA seq 385 aa AA seqDB search
MTHSPLDPQQLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVDRGEVSNLIARWGD
KGHPRTMGFNGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDL
VQTTPPDGAILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDEMGEMIKI
GRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVT
IDTGNPATNVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKDFGVDIAVEIKVSGE
SFITPPGPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGKTMHQVDE
RVEIAQIHQLKSIYGRILRDYFDQN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattcgccactcgacccgcaacagttgaccgccgatctgatccgctgtgcctct
gtcacaccggaggagggcggtgcgctggtccttctggacaaggtgctgagtgcggctggc
tttacctgtacccgtgtggatcgtggcgaggtcagcaatctgattgcccgctggggtgac
aaggggcacccgcgcaccatgggcttcaatggtcataccgatgtggtgccggtaggtgac
acgaatgcctggaccgttgacccttttggtgccgaggagaaagacggttttctctatgga
cgtggggcgactgacatgaaatcgggcgtcgccgcctttgtggctgcggctattgatctg
gtgcagaccacaccgcccgatggggccattctcctgaccatcaccggagacgaagaaggt
gatgccatcgatggcacgaccgcgttgctggaccacatggaccgcgagggcgaacaaatg
gccgtctgtctggtgggagagccgacctgccccgatgagatgggtgagatgatcaagatc
gggcgtcgcgggtcgctgtccgcctggttcacggtcaccggcgtgcagggccattcggcc
tatcctcaccgcgccaagaacccgctgaatgctatggtgcgcctgatggaccgccttgcc
agccacgagttggatcagggcacggagcattttgatgcctccacccttgcggtggtgact
atcgataccggcaacccggctaccaatgtcattcccgcgcagacgcgctccacggtcaat
atccgttttaacgatgcccataccggcgcggagctcagcgattggctgcgcgcagaagcg
gcgcgtgcggcaaaggattttggtgttgatatcgcggtggaaatcaaagtctccggcgag
agtttcatcacgccgccagggccgctgtccgatcttgtcagcgccgcagtcgagaccgag
accggtcgcaaacctcagctgtccaccactggcgggacctcggatgcgcggtttgtcaaa
aaccactgcccggtggttgaagtaggtttggtcggaaaaacgatgcatcaggtcgatgaa
cgggtggaaattgcccagatccaccagctcaaatcgatttatggccgcatcctgcgcgat
tatttcgaccaaaactga

DBGET integrated database retrieval system