KEGG   Phaeobacter inhibens 2.10: PGA2_c34600Help
Entry
PGA2_c34600       CDS       T02193                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase DapE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00300  Lysine biosynthesis
pgl01100  Metabolic pathways
pgl01120  Microbial metabolism in diverse environments
pgl01230  Biosynthesis of amino acids
Module
pgl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PGA2_c34600 (dapE)
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PGA2_c34600 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFO89418
Position
3746810..3747967
Genome map
AA seq 385 aa AA seqDB search
MTHSPLDPQQLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVDRGEVSNLIARWGD
KGHPRTMGFNGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDL
VQTTPPDGAILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDEMGEMIKI
GRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVT
IDTGNPATNVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKDFGVDIAVEIKVSGE
SFITPPGPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGKTMHQVDE
RVEIAQIHQLKSIYGRILRDYFDQN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattcgccactcgacccgcaacagttgaccgccgatctgatccgctgtgcctct
gtcacaccggaggagggcggtgcgctggtccttctggacaaggtgctgagtgcggctggc
tttacctgtacccgtgtggatcgtggcgaggtcagcaatctgattgcccgctggggtgac
aaggggcacccgcgcaccatgggcttcaatggtcataccgatgtggtgccggtaggtgac
acgaatgcctggaccgttgacccttttggtgccgaggagaaagacggttttctctatgga
cgtggggcgactgacatgaaatcgggcgtcgccgcctttgtggctgcggctattgatctg
gtgcagaccacaccgcccgatggggccattctcctgaccatcaccggagacgaagaaggt
gatgccatcgatggcacgaccgcgttgctggaccacatggaccgcgagggcgaacaaatg
gccgtctgtctggtgggagagccgacctgccccgatgagatgggtgagatgatcaagatc
gggcgtcgcgggtcgctgtccgcctggttcacggtcaccggcgtgcagggccattcggcc
tatcctcaccgcgccaagaacccgctgaatgctatggtgcgcctgatggaccgccttgcc
agccacgagttggatcagggcacggagcattttgatgcctccacccttgcggtggtgact
atcgataccggcaacccggctaccaatgtcattcccgcgcagacgcgctccacggtcaat
atccgttttaacgatgcccataccggcgcggagctcagcgattggctgcgcgcagaagcg
gcgcgtgcggcaaaggattttggtgttgatatcgcggtggaaatcaaagtctccggcgag
agtttcatcacgccgccagggccgctgtccgatcttgtcagcgccgcagtcgagaccgag
accggtcgcaaacctcagctgtccaccactggcgggacctcggatgcgcggtttgtcaaa
aaccactgcccggtggttgaagtaggtttggtcggaaaaacgatgcatcaggtcgatgaa
cgggtggaaattgcccagatccaccagctcaaatcgatttatggccgcatcctgcgcgat
tatttcgaccaaaactga

DBGET integrated database retrieval system