KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0039Help
Entry
PGN_0039          CDS       T00714                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pgn00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pgn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48048..50387
Genome map
AA seq 779 aa AA seqDB search
MTMKRLTFGACICCLLSLMACSQKAKQVQIPEYDKGINIIPLPMQLTESDDSFEVDDKTT
ICVSAEELKPIAKLLADKLRASADLSLQIEIGEEPSGNAIYIGVDTALPLKEEGYMLRSD
KRGVSIIGKSAHGAFYGMQTLLQLLPAEVESSNEVLLPMTVPGVEIKDEPAFGYRGFMLD
VCRHFLSVEDIKKHIDIMAMFKINRFHWHLTEDQAWRIEIKKYPRLTEVGSTRTEGDGTQ
YSGFYTQEQVRDIVQYASDRFITVIPEIEMPGHAMAALAAYPQLACFPREFKPRIIWGVE
QDVYCAGKDSVFRFISDVIDEVAPLFPGTYFHIGGDECPKDRWKACSLCQKRMRDNGLKD
EHELQSYFIKQAEKVLQKHGKRLIGWDEILEGGLAPSATVMSWRGEDGGIAAANMNHDVI
MTPGSGGLYLDHYQGDPTVEPVAIGGYAPLEQVYAYNPLPKELPADKHRYVLGAQANLWA
EYLYTSERYDYQAYPRLLAVAELTWTPLAKKDFADFCRRLDNACVRLDMHGINYHIPLPE
QPGGSSDFIAFTDKAKLTFTTSRPMKMVYTLDETEPTLTSTPYTVPLEFAQTGLLKIRTV
TAGGKMSPVRSIRVEKQPFNMSMEVPAPKPGLTIRTAYGDLYDVPDLQQVASWEVGTVSS
LEEIMHGKEKITSPEVLERRVVEATGYVLIPEDGVYEFSTENNEFWIDNVKLIDNVGEVK
KFSRRNSSRALQKGYHPIKTIWVGAIQGGWPTYWNYSRVMIRLKGEEKFKPISSDMLFQ
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
ttgacaatgaaacgactgactttcggagcatgcatttgctgcctcctatctcttatggcc
tgctcacagaaagcaaagcaggtgcaaatccccgaatacgacaagggtataaacatcatt
cccttgccgatgcagctgaccgaatcggacgacagctttgaggtcgatgataagaccact
atctgcgtatctgccgaagagctaaagcctatcgctaaacttcttgccgacaagctaaga
gcatcagccgacctctctctccagatagagataggcgaggagccttcggggaatgctatt
tacatcggtgtcgatacggctcttcctcttaaagaagagggttatatgctccgatccgat
aagcgtggtgtcagtatcatcggcaaatctgcccatggtgctttctacggtatgcagact
ttgctccagctccttcctgccgaagtggaatcttcgaatgaggtactgctccccatgacg
gtgcccggcgtcgagatcaaggacgaaccggcattcggctatcgtggctttatgctggat
gtatgccgtcatttcctttcggtggaggacatcaagaagcatatcgacatcatggccatg
ttcaagatcaatcgtttccattggcacctgacagaggatcaggcatggcgtatcgaaatc
aagaaatacccacgactgaccgaagtggggtctacaaggacggaaggggacggtacgcag
tactccggtttctacacgcaggagcaagtacgggatattgtacaatacgcatcggatcgt
ttcattacggtgattcccgagatcgaaatgcccggacatgccatggctgccctcgctgct
tatccgcagttggcttgcttcccacgcgaattcaagccacggattatctggggagtggag
caggatgtttattgtgccggtaaggacagcgtcttccgttttatctctgatgttatcgac
gaggtagcaccccttttccccggcacatacttccatatcggaggggacgaatgccctaaa
gatcgatggaaggcttgttcgctttgtcagaagcgtatgcgtgacaatgggttgaaagac
gaacacgagctgcagagttatttcatcaaacaagctgaaaaggtcttacaaaagcacggc
aagagactgatcggttgggatgaaatcctcgaaggcgggcttgcaccttctgccaccgtt
atgagctggcgtggagaggatggtggcatcgcagcggctaatatgaatcacgatgtgatc
atgactccgggtagcggaggtctctacttggatcattatcagggagatccgaccgtcgag
cctgttgccatcggaggttatgctccattggagcaagtgtatgcttacaatcctttgccg
aaagaattgccggccgataagcatcgctacgtgctcggagcacaggccaatctgtgggca
gaatacctctatacttccgaacgatacgactatcaggcctatccaaggctactggctgtg
gcagagcttacctggacaccgttggccaagaaagattttgccgatttctgtcgccgtttg
gataatgcctgcgttcgtctggacatgcacggtatcaattaccacattccgctgcccgaa
caaccgggtggctcttccgactttatagcctttacggacaaggctaagctgaccttcacg
acatcgcgtccgatgaaaatggtctatacgctggacgaaaccgaaccgaccctcacatcg
actccttacacggtccctcttgaatttgcacaaacgggccttctgaagattcgtaccgtc
acggccggtgggaagatgagtcccgtacgtagcattcgtgtggagaaacaacccttcaat
atgtcaatggaagtaccggcaccgaaacccggactgaccattcgtacggcttacggtgac
ttatatgatgtgcctgatctgcagcaggtagcctcatgggaagtagggaccgttagctct
ttggaggaaatcatgcacgggaaagagaagataacttctcctgaagtgctggagcgcaga
gttgtagaggctaccggttatgtgcttattccggaggatggggtatatgagttctctacg
gaaaacaacgagttttggattgataatgtgaagctgatcgacaatgtgggcgaagtaaag
aaattctcccgtcgcaatagcagtcgtgcccttcagaaaggttaccatccgatcaagacg
atatgggtcggagccatacaaggtggctggcctacttattggaactacagcagggtaatg
atacggctcaagggagaagaaaagttcaagccgatctcgtccgatatgctctttcaataa

DBGET integrated database retrieval system