KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0055Help
Entry
PGN_0055          CDS       T00714                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Brite
Enzymes [BR:pgn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PGN_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63785..64300)
Genome map
AA seq 171 aa AA seqDB search
MGTRSKLLVLSFCLVCLSCFRLFAQEGGKALFSLPPFERAVVCIKHFEGLHSWKDYPYVG
YGHRLLPCEHFTAAMTERQADSLLRVDLMKRLMMFKDYGKDALLLAVLSYNVGTGRLLGY
GKHPKSRLLRKIESGNRNFYREFVSFCRYKGKVLRGLVKRRKVEFALFYIP
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggggacaagaagtaaacttctcgttttatcgttctgccttgtttgcctatcctgcttc
cgccttttcgctcaggagggcggaaaggctctcttttcactaccgccgttcgagcgtgcc
gttgtctgcatcaaacacttcgagggcttacattcttggaaggattatccctatgtaggc
tatggacatcggcttctgccctgtgaacacttcacggcagcaatgacggaacggcaggcg
gactctctgctccgtgtagacctgatgaagcgtctgatgatgttcaaggactacggaaag
gatgccctgctgcttgccgttctgtcctacaacgttggaacgggcaggttgctgggatat
ggtaaacaccccaaaagccgattgctgcggaagatagagtcgggcaacaggaatttctac
cgcgaatttgtctctttctgccgatacaagggcaaagtcctcagaggtcttgtcaaacga
cgaaaagtggagttcgctctgttttatataccctga

DBGET integrated database retrieval system