KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0204Help
Entry
PGN_0204          CDS       T00714                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PGN_0204
Enzymes [BR:pgn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PGN_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216781..218178
Genome map
AA seq 465 aa AA seqDB search
MDHLTVIIGAGLTGLTTAAFLRAAGRPVLVLERAAHIGGQIRTYRENGFVFETGPNTGTI
SSPEVAELFELLGLEPEIATPAASNRLIWKGNKLYPLPRNIAEAVATPLFSLWDKWRILG
EPFRRRGGQPNETVGALARRRLGKSFVDYAVDPFLGGIYAGDADQLVTRFALPKLYDLEQ
RYGSFVLGAVRKARQPQNERDRKASRKVFSVQGGLGLLVEALADYIGREHILTETQIRYI
NHPGAHTFGLTYTDASEEEHTIPCRHLVSTVAAHHIPTLFDRFPADESAVFEQLYYAPMI
EVAVGFRRNVATHLPAFGCLIPSRENRRILGILFPSDCFRGRAPEGGALYSIFMGGVRNA
SLIDLSDEEISTIAMEELRDMLHIPHTCKPDLLHISRHRHAIPQYYADTELRQDIIRRME
MRWPGLHLGGNMHGGIGMAHRISQGVEMARSIIEETAIAERSARG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggatcatctgaccgtcatcataggagccgggctcaccggactgaccacagccgctttc
ctcagagctgccggcaggcctgttctggttttggagcgagctgctcatatcggcggacag
atacgcacctacagagagaacgggttcgtgttcgagacagggccgaataccggcacgatc
tcctctccggaagtagccgagctattcgaactgctcggattggaacctgagatagccact
cctgcggcctctaaccgtctgatatggaaaggcaacaaactgtatccccttccaaggaac
atcgccgaggcagtcgctactcctctcttttccctgtgggacaaatggcgtatcctcggc
gaacccttccgccggagaggcggacaacccaatgagacggtcggagccttggctcgtcgc
cggctgggcaaaagttttgtggactacgcagtcgatcctttcctcggaggtatttatgca
ggagatgccgaccaactggttactcgctttgccctgcccaaactatacgatctggagcag
cgatacggcagcttcgtactgggtgccgttcgaaaagcccgacagccacaaaacgaacgc
gaccgcaaagcctcgcgcaaggtcttttccgtacaagggggactcggtcttctggtcgaa
gctttggctgactatatcggacgcgaacacatcctgacggaaacgcaaatccgatacatc
aatcacccgggagcacacaccttcggccttacctatacggatgcttcggaagaggagcac
accattccttgccgccacttggtgagtacggtggcagcgcaccatatccccacactgttc
gaccgcttccctgcggatgaatcagccgtgttcgagcagctctattatgcacccatgata
gaggttgccgtagggttccgccggaatgttgccacacacctgccggctttcggttgcctg
atcccttcgagggaaaatcgtcgcatcctcggcatcctgttcccttcggactgtttccgt
ggcagagcacctgaagggggcgcactctattccatattcatgggtggggtgcgaaatgct
tcgctcatagacctttccgacgaggagatcagcacgattgcaatggaagagctgcgcgat
atgctgcacatacctcacacctgtaagccggatctgctgcacatctcacgccaccgccat
gccataccgcagtactacgccgatacggaacttcggcaagacatcatccggcggatggaa
atgcgctggccgggcttgcatttgggtggcaatatgcatgggggaataggtatggcacat
cgtatctcacaaggtgtggaaatggctcgaagtatcatagaagagacagccatcgccgaa
cgctctgccagaggctga

DBGET integrated database retrieval system