KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0243Help
Entry
PGN_0243          CDS       T00714                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:pgn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgn00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:pgn00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pgn00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261930..262676)
Genome map
AA seq 248 aa AA seqDB search
MKRIVLIRHGESLWNKENRFTGWTDVDLSEKGIEEAKKAGELMKKEGFQFTKAYTSYLKR
AVKTLNGVLDVMDLDWIPVEKTWRLNEKHYGMLQGLNKAETAEKYGDEQVLIWRRSYDVP
PTPMEKEDPRSPFMDPRYKGVCEKDLPLTEALCDTVNRILPYWNETIFPTLKEHDEVLVA
AHGNSLRGIIKVLKNISDEDIISLNLPTAVPYVFEFDDNLRLVKDYFLGDPEEIKKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagtattgattcgccacggcgaaagcttgtggaacaaggaaaatcgcttt
acgggatggacagatgtggatttgtccgaaaaaggtattgaagaagccaagaaagccggc
gagctcatgaagaaagaaggctttcagtttaccaaagcctatacttcctatctcaaacgt
gccgtcaagaccctgaacggtgtcctcgatgtaatggacttggattggataccggtggag
aagacctggcgtctgaacgagaagcactacggcatgctgcaaggcctcaacaaggccgag
actgccgagaagtacggagatgaacaggtactcatctggcgtcgcagctacgatgttccc
cctacgcctatggagaaagaggatccgcgctctccgttcatggatccgcgctacaaaggt
gtgtgcgagaaagacctgccactgacagaagctctctgcgacacggtaaatcgtatcctc
ccctactggaacgagaccatattccctacactcaaggagcatgacgaggtattggtagcg
gctcacggcaacagtctgcgtggtatcatcaaggtgctgaaaaacatttcggacgaagac
atcatcagcctgaacctcccgacagccgtgccttacgtttttgaatttgacgacaatctc
cggctggtgaaagactatttcctcggcgatcccgaagaaatcaaaaagctgatggaggca
gtagccaatcagggcaagaagaagtaa

DBGET integrated database retrieval system