KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0243Help
Entry
PGN_0243          CDS       T00714                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGN_0243 (gpmA)
   01230 Biosynthesis of amino acids
    PGN_0243 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGN_0243 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PGN_0243 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGN_0243 (gpmA)
Enzymes [BR:pgn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PGN_0243 (gpmA)
Exosome [BR:pgn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PGN_0243 (gpmA)
  Exosomal proteins of melanoma cells
   PGN_0243 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261930..262676)
Genome map
AA seq 248 aa AA seqDB search
MKRIVLIRHGESLWNKENRFTGWTDVDLSEKGIEEAKKAGELMKKEGFQFTKAYTSYLKR
AVKTLNGVLDVMDLDWIPVEKTWRLNEKHYGMLQGLNKAETAEKYGDEQVLIWRRSYDVP
PTPMEKEDPRSPFMDPRYKGVCEKDLPLTEALCDTVNRILPYWNETIFPTLKEHDEVLVA
AHGNSLRGIIKVLKNISDEDIISLNLPTAVPYVFEFDDNLRLVKDYFLGDPEEIKKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagtattgattcgccacggcgaaagcttgtggaacaaggaaaatcgcttt
acgggatggacagatgtggatttgtccgaaaaaggtattgaagaagccaagaaagccggc
gagctcatgaagaaagaaggctttcagtttaccaaagcctatacttcctatctcaaacgt
gccgtcaagaccctgaacggtgtcctcgatgtaatggacttggattggataccggtggag
aagacctggcgtctgaacgagaagcactacggcatgctgcaaggcctcaacaaggccgag
actgccgagaagtacggagatgaacaggtactcatctggcgtcgcagctacgatgttccc
cctacgcctatggagaaagaggatccgcgctctccgttcatggatccgcgctacaaaggt
gtgtgcgagaaagacctgccactgacagaagctctctgcgacacggtaaatcgtatcctc
ccctactggaacgagaccatattccctacactcaaggagcatgacgaggtattggtagcg
gctcacggcaacagtctgcgtggtatcatcaaggtgctgaaaaacatttcggacgaagac
atcatcagcctgaacctcccgacagccgtgccttacgtttttgaatttgacgacaatctc
cggctggtgaaagactatttcctcggcgatcccgaagaaatcaaaaagctgatggaggca
gtagccaatcagggcaagaagaagtaa

DBGET integrated database retrieval system