KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0380Help
Entry
PGN_0380          CDS       T00714                                 

Definition
partial ROK family transcriptional repressor with glucose kinase domain
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGN_0380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGN_0380
   00052 Galactose metabolism
    PGN_0380
   00500 Starch and sucrose metabolism
    PGN_0380
   00520 Amino sugar and nucleotide sugar metabolism
    PGN_0380
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGN_0380
   00524 Butirosin and neomycin biosynthesis
    PGN_0380
Enzymes [BR:pgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PGN_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
414732..415511
Genome map
AA seq 259 aa AA seqDB search
MEKPYVLGVDVGGTNTVFGVVDARGNLVISSSIKTGAHNDLNDYIKDLTAGINQLIEQVG
GKEKIKGIGVGAPNGNYYTGSIEFAPNLPWKQTKIPFAQMLTDSLGIPTTLTNDANAAAI
GEMTYGAARGMKDFIVITLGTGVGSGIVVNGSLVYGHDGFAGELGHMIVRRNGRMCGCGR
QGCLETYTSATGVARTAREYLDIRSDKSLLRNIQPDLIREFDIKKWHNTLVISVFYFPHS
VFQALILLSDGFLSTSETQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccttatgtattaggagtggatgtaggcggtaccaacaccgtattcggagtg
gtggacgctcgtggcaatttggttataagttcgtccatcaagaccggagcgcacaacgat
ctgaacgattatatcaaagatctgactgccggcatcaatcagttgatcgaacaggtagga
gggaaagagaagataaagggtatcggtgtaggtgctcccaatggaaactattataccgga
tcgatcgagtttgcgcccaatttgccttggaaacagaccaaaatacccttcgcccaaatg
ctcaccgattcattaggtatccccacgacactgaccaatgatgccaatgctgctgccatc
ggggagatgacctatggagcagctcgtggcatgaaggacttcatcgttatcacgctcggt
acgggggtcggaagcggcatagtagtcaatggcagcttggtgtacggacacgatggattt
gccggtgagctgggacacatgatcgttcgccgcaatggtcgcatgtgcggttgtggcaga
cagggctgtctcgagacttacacctctgctacaggagtagcccgtacagctcgtgaatat
ctggacatccgttcggacaagagcttgctccggaacattcagcccgatctgatacgtgag
ttcgatataaagaaatggcacaacacattggttattagtgtgttttattttccacacagt
gtttttcaggcacttatattgctttcagatggctttttatctacatctgaaacccaatga

DBGET integrated database retrieval system