KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0483Help
Entry
PGN_0483          CDS       T00714                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGN_0483
   00052 Galactose metabolism
    PGN_0483
Enzymes [BR:pgn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PGN_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530166..531233
Genome map
AA seq 355 aa AA seqDB search
MNQISLPQRSSFTSCLNGKDVDLYHLTNGKGIDAYITNYGARIVALIVPDKDGNRTDVVL
GHDSLQEYIDSEEQYFGAVCGRYANRIARGSFSIDGRCYSLPINNGPNSLHGGISGFNTK
VWEVKSAGPSSLVLEYVSADGEEGYPGELVVRIIYSVTDEGALHIDYRATADAPTVLNLT
NHSYFNLSGAGDPSVHDHTLMIQARHYLPTDDTAIPYGEPAEVEGTPFDFLTPHGIGDRI
DSAMDQLIWAKGYDHTFIVDKPSGAYGFCSRCVSPKTGIVLDVYSSEPGMQVYTGNWMSG
KLRGKSDRRYPARSAVCFETQHYPDSPNKPNYPTTLLRPGEVFESRTAFRFGIVE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagccttccgcaacgatcctcctttacctcctgcctgaatggtaaggat
gtggatctctaccatttgaccaatggaaaaggaatagacgcttatattaccaactacggt
gcccgaatcgttgccctcatcgtgccggacaaagacggcaatcggacggacgtcgtcctg
gggcacgactccctacaggaatacatcgactcggaggagcagtatttcggtgccgtctgc
ggcaggtatgccaacaggattgcccgcggttctttctccatagacggcagatgctacagc
ctgccgatcaacaatgggccgaactctctgcatggcggcatcagcggatttaatacgaag
gtctgggaggtgaaatccgccggcccctcttcgcttgtgctggaatacgtgtcggcagat
ggagaggaggggtatccgggcgagctggtcgttcggatcatttacagcgtcacggatgag
ggcgcattgcacatagactatcgtgctacggcggatgctcctacggttctgaatctgacc
aatcactcctatttcaatctctcgggtgcaggcgatccctccgtgcatgatcataccctc
atgatacaagcccggcattatctccccacagacgatacggccatcccttacggcgagcct
gccgaggtcgaggggacgccgttcgatttcctcacgcctcacggcataggggatcggatc
gacagtgcgatggatcagctcatttgggcaaagggatacgatcatacctttatcgtggac
aagccgtcgggggcatatggcttttgcagccgttgcgtatcgcccaagaccggaatcgta
ttggatgtctattcctccgaaccgggtatgcaggtgtacacgggcaactggatgagcgga
aagctgagggggaagtccgatcggcgttatccggctcgctcggccgtttgtttcgagacg
cagcactatcccgattcgccgaacaaaccgaattatcctacgaccctcttgcgcccgggc
gaagtgttcgagtcccggacggcgttccgattcggtatcgtcgagtga

DBGET integrated database retrieval system