KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0483Help
Entry
PGN_0483          CDS       T00714                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgn00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgn00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530166..531233
Genome map
AA seq 355 aa AA seqDB search
MNQISLPQRSSFTSCLNGKDVDLYHLTNGKGIDAYITNYGARIVALIVPDKDGNRTDVVL
GHDSLQEYIDSEEQYFGAVCGRYANRIARGSFSIDGRCYSLPINNGPNSLHGGISGFNTK
VWEVKSAGPSSLVLEYVSADGEEGYPGELVVRIIYSVTDEGALHIDYRATADAPTVLNLT
NHSYFNLSGAGDPSVHDHTLMIQARHYLPTDDTAIPYGEPAEVEGTPFDFLTPHGIGDRI
DSAMDQLIWAKGYDHTFIVDKPSGAYGFCSRCVSPKTGIVLDVYSSEPGMQVYTGNWMSG
KLRGKSDRRYPARSAVCFETQHYPDSPNKPNYPTTLLRPGEVFESRTAFRFGIVE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagccttccgcaacgatcctcctttacctcctgcctgaatggtaaggat
gtggatctctaccatttgaccaatggaaaaggaatagacgcttatattaccaactacggt
gcccgaatcgttgccctcatcgtgccggacaaagacggcaatcggacggacgtcgtcctg
gggcacgactccctacaggaatacatcgactcggaggagcagtatttcggtgccgtctgc
ggcaggtatgccaacaggattgcccgcggttctttctccatagacggcagatgctacagc
ctgccgatcaacaatgggccgaactctctgcatggcggcatcagcggatttaatacgaag
gtctgggaggtgaaatccgccggcccctcttcgcttgtgctggaatacgtgtcggcagat
ggagaggaggggtatccgggcgagctggtcgttcggatcatttacagcgtcacggatgag
ggcgcattgcacatagactatcgtgctacggcggatgctcctacggttctgaatctgacc
aatcactcctatttcaatctctcgggtgcaggcgatccctccgtgcatgatcataccctc
atgatacaagcccggcattatctccccacagacgatacggccatcccttacggcgagcct
gccgaggtcgaggggacgccgttcgatttcctcacgcctcacggcataggggatcggatc
gacagtgcgatggatcagctcatttgggcaaagggatacgatcatacctttatcgtggac
aagccgtcgggggcatatggcttttgcagccgttgcgtatcgcccaagaccggaatcgta
ttggatgtctattcctccgaaccgggtatgcaggtgtacacgggcaactggatgagcgga
aagctgagggggaagtccgatcggcgttatccggctcgctcggccgtttgtttcgagacg
cagcactatcccgattcgccgaacaaaccgaattatcctacgaccctcttgcgcccgggc
gaagtgttcgagtcccggacggcgttccgattcggtatcgtcgagtga

DBGET integrated database retrieval system