KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0522Help
Entry
PGN_0522          CDS       T00714                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571504..572349
Genome map
AA seq 281 aa AA seqDB search
MKRKTLNLGGRLFSLEKPVVMGIMNITPDSFYSGSRLSSVDSVRSRAREIVEEGGALIDV
GAYSSRPNADHISAQEEMERLRPALKVLRDEFSDMPVSVDTFRADVAKMCVEEYGVAIVN
DISGGQLDGDMFRTVAALQVPYILMHMRGTPATMQSLTDYEDIAVDILDYFVERVGELRG
LGLHDIILDPGYGFSKTLEQNYELLSRQEEAFGELELPILVGISRKSMIYKLFGTTPEEA
LNGTTALNMYSVMHGADILRVHDVREAVEVCRIADKLGVVK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaagactctcaacctcggcggcaggcttttcagtctggaaaagcctgtcgta
atgggcattatgaatatcacccccgattctttttactccggcagccgcctctcgagcgtg
gacagtgtgcggagtcgggcacgcgaaatcgtggaagaaggaggggccttgatcgacgtc
ggtgcttattcttcacgtcctaatgcggatcacatatcggcacaggaggaaatggagcga
ctgcgcccggcactgaaagtattgcgggatgagttttcggacatgccggtatcggtggat
accttccgtgccgatgtggcgaagatgtgtgtagaagagtacggggtagccatcgtcaac
gatatttccggcggacagctcgacggcgatatgttccgtacggtggcggctttgcaagtg
ccctatatcctgatgcacatgcgcggcacaccagctacgatgcagagcctcaccgactac
gaagacattgcggtagatatactggattacttcgtggagcgtgtcggagagctgcgcgga
ttgggtctgcacgacattatcctcgatccgggttatggtttcagcaagacgctggagcag
aattacgaattgctatcgcggcaggaggaggctttcggcgagctggagcttcccatcctg
gtcgggatctcgcgcaagagtatgatctacaaactattcggcaccactccggaggaagct
ctcaacggtaccacggcactgaatatgtacagtgtcatgcatggggcggacattcttcgg
gtgcacgatgtgcgggaagcggtggaagtatgccgtatagccgacaaactcggcgtcgtc
aagtaa

DBGET integrated database retrieval system