KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0547Help
Entry
PGN_0547          CDS       T00714                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PGN_0547
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGN_0547
Enzymes [BR:pgn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PGN_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
597360..597950
Genome map
AA seq 196 aa AA seqDB search
MNFIPTEIPEVVILEPRLFRDDRGYFFESFSRQEIETGIRPINFVQDNESASRYGVLRGL
HFQKPPHAQSKLVRVVRGCVIDYAVDIRFGSPTFGKYVAVELSDTNFRQLFIPRGFAHGF
VVLSDEVVFQYKCDNYYAPQSEGAIAWNDSNLDIDWKIPVEDIILSAKDQANPSWTELIS
SEDFRNLFPYNQDLYE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatccccaccgaaatacccgaagtcgttatccttgagccacgattgttccgt
gacgatcgaggctatttcttcgaatcattcagtcgccaagagatagaaacgggtattcgc
cccattaattttgtacaagacaacgaatcggcatcccgatatggtgtactaagagggctt
cacttccagaaacctccacatgctcagagcaagctggtacgagtagtacgtgggtgtgtg
attgactatgccgtggatattcgcttcggatcgcctactttcggcaaatatgtagcagtg
gagctttccgatacgaacttcagacagttgtttatcccgcgcggattcgctcacggtttt
gtcgtgctaagtgacgaagtcgtatttcagtacaaatgcgacaactactatgctccacaa
agcgaaggagccattgcctggaatgattcgaacttagatattgactggaaaatccctgta
gaggacattatcctctcagctaaagatcaggccaatccgtcatggacggaattgatatcg
agcgaggatttccggaatctcttcccctacaatcaagacttatacgaatga

DBGET integrated database retrieval system