KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0627Help
Entry
PGN_0627          CDS       T00714                                 

Gene name
murG
Definition
undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
Orthology
K02563  
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pgn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685521..686660
Genome map
AA seq 379 aa AA seqDB search
MNNEKSNAKLRFIISGGGTGGHIFPAISIADALRRRYPECEILFVGAEGRMEMERVPRSG
YEIVGLPIKGLDRKHLLSNYKVAIAVIRSMRLANKTIRNFRPDMVIGVGGYASGPTLRRA
HSLGIPTLIQEQNSYAGVTNKLLSRGAHKICVAYPEMDKFFSPEKIVFTGNPVRPEIEFG
HPSRSESLRFFGFEQSESPVVLVVGGSLGALTINKSITDKLGKWAESGVHLIWQTGKNYI
ETARKAVENHPGLKCYVNDFITRMDYAYCAADLVVSRAGACSISELCLLGKPTILVPSPN
VAEDHQTKNALALSTRAAAVLIPDTEAIELLTDTALSLVRNLAELSSLSEQIRTLAKPQA
ADRIVDEIARIVEHEKRAN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaaaaatcaaacgccaaactgcgttttatcataagtgggggaggaactggc
ggacatatttttccggctatttccatcgctgatgccctgcgtcgccgctatcccgaatgt
gaaatcctttttgtgggtgctgagggacggatggaaatggagcgtgtaccccgatccggc
tacgagatcgtaggtctacccatcaaagggttagacagaaagcatttgttgtcgaattac
aaggtagccattgctgttatccgaagcatgaggctggctaataagaccataaggaatttt
cgtcctgatatggtaatcggtgtaggaggctatgccagtggcccaaccttacgcagagca
cattccctcgggatccccaccctcattcaagagcaaaacagctatgccggtgtaacgaat
aaactgctgagccgaggagcgcataaaatctgcgtggcttatcccgaaatggataaattc
ttctctcctgaaaagatcgtttttaccggcaatccggttcgccctgaaatagaattcggc
caccccagccgctcggagtctcttcgctttttcggcttcgagcagtccgaatcgcctgtc
gtcttggtagtcggagggagcttgggagcccttactattaacaagagtatcaccgacaag
ctcggcaaatgggcagaaagcggtgtacaccttatatggcaaacgggaaagaactatatc
gagacagccagaaaagcagtagagaatcatcccgggttgaaatgctatgttaatgatttt
atcactcgaatggattatgcatactgtgcagccgacttggtagtgtcacgagccggagct
tgctccatttcagagctttgcttgctgggaaaacctacgatactggttccctcgcccaat
gtagcagaagaccatcaaacaaagaatgcattggctctttctacgcgcgctgctgccgtt
ctgattccggataccgaggcaatagaactgttaaccgacacagctctatccttggttcgc
aatctggcagaattgagttctctgagcgaacagatacgaacgctggccaaacctcaggca
gctgatcgaattgtggatgagatagcaagaatagtggaacacgagaaaagagcgaattga

DBGET integrated database retrieval system