KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0701Help
Entry
PGN_0701          CDS       T00714                                 

Gene name
lacZI
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgn00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pgn00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pgn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758844..762215
Genome map
AA seq 1123 aa AA seqDB search
MRNFLLTLAVTLTAASVVFSAEAQVTESGLPYWKDIRTVSVNKEPARSSFMTYADRSEAL
TGKYEKSSYYRLLNGTWRFFYAESEAHLPAGITDSSANTEGWHDIQVPGNWEIQGHGVAI
YTNHGYEFQPRNPQPPKLPEANPVGVYRREIEVPTDWMERDIYLHIAGAKSGLYVYINGH
EAGYSEDSKNPAEFLINPYVHAGKNTLTLKIYRWSTGSYLECQDFWRISGIERDVFLYAQ
PKAAVKDFSIKSTLDDSYRNGIFSLKADLRNRRDEASELSLTYELLDAEGKTIATETRST
LIAAGGEHTLSFEAQPSAVHTWTSEHPYLYKLLMTVREKGKVTEVIPSRVGFRRIEIKPI
EEKAANGMPYVCFFVNGQPIKLKGVNMHEHNPATGHYVPEELMRRDLELMKQHNLNAVRL
AHYPQDRRFYELCDEYGLYVYDEANIESHGMYYNLRRGGTLGNNPEWLKPHMDRIANMFE
RNKNHPCVTIWSLGNEAGNGYNFYQAYLWLKEADRDLMARPVNYERAQWEWNTDMYVPQY
PDAKWLEGIGRAGSDRPVIPSEYAHAMGNSTGNLWGQWQAIYKYPNLQGGFIWDWVDQGI
LRTDDKGKSYWAYGGDFGVDAPSDGNFLCNGLVNPDRTPHPAMQEVKYVHQNVGFEAVDA
AKGHFRITNRFYFTNLKKYRLRYTVSANGKALQSKVIGLDLDPQTSSDIIVPVDRLRPTA
GLEYFVDFSVQTLQAEPLIPIGYEIAHDQFRLPIDAERTAYRATGPTLHTSTEGDELKVV
SSKVDFVFNKKSGLVTSYRVDGREFFKDRFGIQPNFWRAPTDNDYGNGAPKRLQIWKESS
RDFQVVEAGLSNEGNTVLLKATYLLAAGNLYGLTYKIYPDGVVNVKVQFSSTDMETDEYE
WSEAARTATFSPGREALRKEASILEVPRIGVRFRLPADLNDLRYFGRGPDENYIDRNYGA
TVGLYTTAADKMYYNYVRPQENGHRTDTRWLMLHGRGLGLGIVADETIGFNALRQAVEDF
DSEEAKHRPYQWNNYSQTEIQNRDESKARNVLRRQHHVNDVPVRDFVEVCVDMKQQGVGG
YDSWSALPEPQHRLPSNREYSWSFTLLPVRSVGQMATATRYAY
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatttcctattgacacttgcggtaactttgactgccgcaagtgtcgttttcagt
gcagaggcacaggtcacagagtcggggcttccatattggaaggatattcgtacggtaagc
gtaaacaaagaaccggcgcgttcgtcctttatgacctatgccgaccgaagcgaagctctc
accggcaagtatgagaagagttcgtactaccgtcttctgaacggcacgtggcgattcttt
tatgccgagagcgaggcacatctgcctgccggcataacggatagctcggcaaatacagag
ggatggcacgacatccaagtccccggcaactgggagatacaggggcacggtgtggccatc
tataccaatcacggatacgagtttcagcctcgcaatccgcagccgcccaaactgccggaa
gccaaccccgtaggtgtgtatcggcgcgagatagaagtacccacggactggatggagcgc
gatatctacctccatatagccggagccaagtccggactctatgtctatatcaacggacac
gaagcgggctacagcgaagactccaagaatccggccgaattcctcatcaatccctatgtc
catgccggaaaaaacacgctcacgctcaagatctatcgttggagtaccggctcgtatctg
gaatgtcaggacttctggcgcatcagtgggatcgaacgcgatgtattcctctatgcacaa
cccaaggcggcagtgaaggatttcagcatcaaatccacactcgacgatagctaccgcaat
ggtatattctccctgaaagccgacttacgcaaccgccgtgacgaagcctccgagctatct
ctgacatacgaattgctcgatgccgaaggaaagaccatcgccaccgaaacccgttcgact
ctcatagctgccggcggagagcataccctctctttcgaagcacagccgagtgcggtacat
acatggacgtcggagcatccctatctctataagctcttgatgacggtacgagagaaaggg
aaagtcaccgaggtaataccgtcccgtgtgggtttccgcaggatcgaaatcaaaccgata
gaggaaaaagcggccaacggtatgccctacgtatgcttctttgtcaatggacagcccatc
aagctgaaaggggtgaatatgcacgaacataatcccgccaccggtcattacgtgccggaa
gagctgatgcgtcgggatttggagctgatgaagcagcacaatctgaatgccgtccggctg
gcacactacccgcaagatcgccgtttctacgagctatgcgacgaatacggactctacgtg
tacgacgaggccaatatcgaaagtcacggcatgtactacaacctgcgccgtgggggtacc
ttgggcaataatccggagtggctgaagcctcatatggatcgtatagcgaatatgttcgaa
cgcaacaaaaaccatccgtgcgttacgatctggtcgctcggcaatgaagcaggcaacggg
tacaacttctatcaggcctatctttggctgaaagaggccgatcgcgatctgatggcgcgc
ccggtgaactacgaacgtgcccaatgggagtggaatacggatatgtatgtaccccaatat
cccgatgcgaaatggttggaaggtattggacgggccggtagcgaccgccctgtgatccct
tcggaatacgctcacgccatgggcaattcgaccggcaacctatgggggcagtggcaggct
atctacaagtaccccaatctgcaaggcggcttcatctgggactgggtggatcaaggtatc
ctccgtacagatgataaaggaaagtcctattgggcttatggaggagacttcggagtggat
gcaccgagtgacggcaacttcctttgcaacggactggtcaatcccgaccgcacgcctcac
cctgccatgcaggaggtgaagtatgtgcatcaaaacgtcggcttcgaagcagtggatgcc
gccaagggacatttccgtatcacgaatcggttctacttcaccaacctcaagaaataccgc
ctgcgctatacggtttcggctaatggcaaagcattgcaaagcaaggtcatcggcttagat
ctcgatcctcagacttcatcggacattattgtacccgtagacaggctgaggccgactgcc
ggtctggaatacttcgttgacttcagcgtacagactctacaggcagagccgctgattcct
atagggtatgagattgctcacgatcaattccgacttccgatcgatgcagagagaactgcc
tatcgtgcaacaggccctacattgcacacgagcacggaaggagatgaattgaaggtcgtt
tcgtcgaaagtcgatttcgttttcaacaaaaagagcggattggttacctcttatcgggtg
gacggtcgagagtttttcaaagacagattcggcatacagcccaatttctggcgtgctccc
accgataacgactacggcaatggtgctccaaaacgcttgcagatatggaaggaatcgagc
cgtgatttccaagtagtcgaagcaggattgtccaacgaagggaataccgtcctactcaaa
gctacctatctgcttgccgccggcaacctctacggcttgacctataaaatatatcccgat
ggtgtggtgaatgtgaaggtgcaattctcttcgacagatatggagaccgacgaatacgaa
tggtccgaagctgcccgaaccgctacattctcccccggcagagaagctctgcgcaaggaa
gcttctatcctcgaagtgcctcgtataggtgtacgcttccgccttcctgcggacttgaat
gatttgcgatacttcggaagagggccggatgagaactatatcgaccgcaactacggggcg
actgtcggtctgtacaccactgctgccgataagatgtactacaactatgtgcgtccgcaa
gagaacgggcatcgtaccgatacgcgttggctgatgctgcacggacgaggcttgggcttg
ggcatagtagccgacgaaacgatcggcttcaatgctcttcggcaagctgtcgaggacttc
gactcagaagaagccaagcacagaccctaccagtggaacaactattcacagaccgagata
caaaaccgagatgagagcaaagctcgcaacgtcctccgtcggcagcatcatgtcaatgat
gtgcctgtgcgcgacttcgtagaggtgtgcgtggatatgaaacaacaaggagtaggagga
tacgatagctggtcggctcttcccgaacctcagcaccgcctaccgtccaatcgggaatac
agttggagctttacccttcttccggtacgatcagtcggccaaatggccactgccacccga
tacgcctactaa

DBGET integrated database retrieval system