KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0714Help
Entry
PGN_0714          CDS       T00714                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pgn00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
776408..776920
Genome map
AA seq 170 aa AA seqDB search
MVLLIVDPQVDFVSGSLAVEGAPKAMKALAEYMAAHRKEIKSIVVTMDQHPADHCSFVAQ
GGQWPSHCVRYTVGAAIEPCIAEALAACSAEGIPVEMIEKATTQERDAYSAFETEVPDSL
RSAERIVMAGIAGDYCVRQSVLDLERHGLGERIELLKEGIAYIAEEENRP
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggtacttttgatcgtggatccgcaggtggatttcgtaagcggttcgttggctgtcgaa
ggtgcaccgaaagccatgaaggctttggctgaatatatggctgcacatcggaaggagata
aagtctatcgtcgtgacgatggatcagcatccggccgatcattgcagcttcgtggcacag
ggcggacagtggccgtcgcattgtgtccgctatacggtgggagccgctatcgaaccatgc
attgcggaggctctggctgcttgttcggccgagggtatccctgtcgaaatgatagagaag
gctactacgcaggagcgcgatgcttacagtgccttcgagacggaagtacccgattcgttg
cgctcggccgaacgtatagtcatggccggaatagcgggcgattactgcgtgcgtcagagc
gtgctcgatctggagcgtcatggtctcggcgagcgcatcgaacttctcaaggagggaatt
gcctatatagcggaagaggaaaaccggccataa

DBGET integrated database retrieval system