KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0714Help
Entry
PGN_0714          CDS       T00714                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PGN_0714
Enzymes [BR:pgn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PGN_0714
    3.5.1.-  
     PGN_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
776408..776920
Genome map
AA seq 170 aa AA seqDB search
MVLLIVDPQVDFVSGSLAVEGAPKAMKALAEYMAAHRKEIKSIVVTMDQHPADHCSFVAQ
GGQWPSHCVRYTVGAAIEPCIAEALAACSAEGIPVEMIEKATTQERDAYSAFETEVPDSL
RSAERIVMAGIAGDYCVRQSVLDLERHGLGERIELLKEGIAYIAEEENRP
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggtacttttgatcgtggatccgcaggtggatttcgtaagcggttcgttggctgtcgaa
ggtgcaccgaaagccatgaaggctttggctgaatatatggctgcacatcggaaggagata
aagtctatcgtcgtgacgatggatcagcatccggccgatcattgcagcttcgtggcacag
ggcggacagtggccgtcgcattgtgtccgctatacggtgggagccgctatcgaaccatgc
attgcggaggctctggctgcttgttcggccgagggtatccctgtcgaaatgatagagaag
gctactacgcaggagcgcgatgcttacagtgccttcgagacggaagtacccgattcgttg
cgctcggccgaacgtatagtcatggccggaatagcgggcgattactgcgtgcgtcagagc
gtgctcgatctggagcgtcatggtctcggcgagcgcatcgaacttctcaaggagggaatt
gcctatatagcggaagaggaaaaccggccataa

DBGET integrated database retrieval system