KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0723Help
Entry
PGN_0723          CDS       T00714                                 

Definition
succinate-semialdehyde dehydrogenase
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pgn00650]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790656..792011)
Genome map
AA seq 451 aa AA seqDB search
MEIKEMVSLARKAQKEYQATHNQEAVDNICRAAAKVIYENAAILAREAVDETGMGVYEHK
VAKNQGKSKGVWYNLHNKKSVGILNIDERTGMIEIAKPIGVVGAVTPTTNPIVTPMSNII
FALKTCNAIIIAPHPRSKKCSAHAVRLIKEAIAPFNVPEGMVQIIEEPSIEKTQELMGAV
DVVVATGGMGMVKSAYSSGKPSFGVGAGNVQVIVDSNIDFEAAAEKIITGRAFDNGIICS
GEQSIIYNEADKEAVFTAFRNHGAYFCDEAEGDRARAAIFENGAIAKDVVGQSVAFIAKK
ANINIPEGTRILVVEARGVGAEDVICKEKMCPVMCALSYKHFEEGVEIARTNLANEGNGH
TCAIHSNNQAHIILAGSELTVSRIVVNAPSATTAGGHIQNGLAVTNTLGCGSWGNNSISE
NFTYKHLLNISRIAPLNSSIHIPDDKEIWEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaagaaatggtgagccttgcgcgcaaggctcagaaggagtatcaagctacc
cataaccaagaagcagttgacaacatttgccgagctgcagcaaaagttatttatgaaaat
gcagctattctggctcgcgaagcagtagacgaaaccggcatgggcgtttacgaacacaaa
gtggccaagaatcaaggcaaatccaaaggtgtttggtacaacctccacaataaaaaatcg
gttggtatcctcaatatagacgagcgtaccggtatgatcgagatcgcaaagcctatcgga
gttgtaggagccgtaacgccgacgaccaacccgatcgttactccgatgagcaatatcatc
tttgctcttaagacttgcaatgccatcattattgccccccaccccagatctaaaaaatgc
tctgcacacgcagttcgtctgatcaaagaagctatcgctccgttcaacgtaccggaaggt
atggttcagatcatcgaagaacccagcatcgagaagacgcaggaactcatgggcgccgta
gacgtagtagttgctacgggtggtatgggcatggtgaagtctgcatattcttcaggaaag
ccttctttcggtgttggagccggtaacgttcaggtgatcgtggatagcaacatcgatttc
gaagctgctgcagaaaaaatcatcaccggtcgtgctttcgacaacggtatcatctgctca
ggcgaacagagcatcatctacaacgaggctgacaaggaagcagttttcacagcattccgc
aaccacggtgcatatttctgtgacgaagccgaaggagatcgtgctcgtgcagctatcttc
gaaaatggagccatcgcgaaagatgtagtaggtcagagcgttgccttcattgccaagaaa
gcaaacatcaatatccccgagggtacccgtattctcgttgttgaagctcgcggcgtagga
gcagaagacgttatctgtaaggaaaagatgtgtcccgtaatgtgcgccctcagctacaag
cacttcgaagaaggtgtagaaatcgcacgtacgaacctcgccaacgaaggtaacggccac
acttgtgctatccactccaacaatcaggcacacatcatcctcgcaggatcagagctgacg
gtatctcgtatcgtagtgaatgctccgagtgccactacagcaggcggtcacatccaaaac
ggccttgccgtaaccaatacgctcggatgcggatcatggggtaataactctatctccgag
aacttcacttacaagcacctcctcaacatttcacgcatcgcaccgttgaattcaagcatt
cacatccccgatgacaaagaaatctgggaactctaa

DBGET integrated database retrieval system