KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0779Help
Entry
PGN_0779          CDS       T00714                                 

Gene name
upp
Definition
uracil phosphoribosyltransferase
Orthology
K00761  
uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PGN_0779 (upp)
Enzymes [BR:pgn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     PGN_0779 (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848250..848900
Genome map
AA seq 216 aa AA seqDB search
MEVIHLGAEHSLLNRFVMEMRDVTIQNDRLRFRRNIERVGEVMAYEISKKMTQQVRTVTT
PLGEAECSVPQDKVVLATILRAGLPFHHGFLNYFDYCENAFVSAYRKYKDRLNFDIHIEY
IASPDITDKVLIISDPMLATGSSMELAYKALLTKGNPKHIHIASIIASQQAVDYIRGVMP
DNTTIWIAAIDPTIDEHSYIVPGLGDAGDLAYGEKL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaatacacttaggtgccgagcattctcttctcaatagattcgtcatggagatg
cgcgatgtcactattcagaacgatcgactgcgctttcgtcgcaatatagaacgtgtggga
gaagtaatggcctatgagatcagcaagaagatgacccaacaggtgcgtaccgtcactacg
cccttgggtgaggccgagtgctccgtaccccaagacaaagtagtgctcgctacgatcctt
cgcgcaggactgcctttccatcatggcttcctcaactatttcgactattgtgaaaatgcc
tttgtatccgcctacaggaagtataaggaccgcctgaatttcgacatccacatcgaatac
atagcatcgccggacatcacagacaaagtcctcatcatatccgatcccatgttggccaca
ggtagctccatggaactggcatacaaagcgctgctgaccaaaggcaatccgaaacatatc
catatagccagcataatagccagccagcaagccgtggactatatacgcggtgtcatgccg
gacaatactacaatatggattgcagccatcgaccccaccatagacgagcattcctatatc
gtgccgggattaggcgacgcaggcgatttggcctatggcgaaaagctttga

DBGET integrated database retrieval system