KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0793Help
Entry
PGN_0793          CDS       T00714                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGN_0793
Enzymes [BR:pgn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PGN_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(870605..873298)
Genome map
AA seq 897 aa AA seqDB search
MEIVFSIKYRADWGQRLCISGSSAELGNWDEALALELTATGEDRWEGRVIIDGRRKDIQY
YYLVRDAEGNAIRKEWKRMHHLVLDHGYKRVLMDDYWIDRPKNAPFFSSAFYDVFFRHEE
KLKRAPKPTKEGVKVVMQLYAPCVHPDQKICMTGNSPALGNWSVEQARAMHHLGKGEWSI
TLEKDELPPLLEYKFFIAGQDDCSDIRWEEGENRSYRFEETDAYGAVYLAGLCFREGDYM
PRYAGSVIPLFGLRTHKDWGIGDFGALRRMVDWAAMTGQRIIQLLPINDTTYTRSYRDSY
PYNIVSVIAIHPIYADLDALPRLKNSALMAKMEKQAEALRALKQMDYPAVLALKEEFLHA
LYRQEGANVMRKKAFRQFVSAAADWLDPYAAFCHLRDKYEGLPLHLWPEYTWGKNQIERM
AVSPELKTETNYYRFVQFLLHEQLHAVSAYAEEKGILLKGDIPIGVSPNSVEVWMEPSLF
DTEHAAGSPPDQFSENGQNWGFPIYRWDVMSRNGFAWWRKRFESMADYFKAFRIDHILGF
FRIWEIPVKHVSGLLGHFNPAIAMTEKEIKEYGFPFDARFCSLPLVHADDLKQIFGRYAS
EVCCRYLRPFDSDYYTLATKNFYQTDIAALDPTAVVGGEDTIRGLMRVATEVCFVIESGK
PGAFHPRIHFEKSFRYAHLSLEEKKAWQHLSDDYFYKRNDDLWKQEALSRLIPLLSSTDM
LVCVEDLGMIPPAVPVVMEQLQLLSLILERISKEPGQDFADMSRQPYCSVCTTSTHDMAP
LRLWWQENELLRRHYYSMILGEKGTAPETCTPETARRILRQHLLSTSMLAIFPLADWLSL
SGELQGIVAPEDEQINKPEISDHYWRYRMPISIESLSEDYRELNESIASLIRTSGRG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggagatagttttttcgatcaagtatcgagccgattgggggcaacgcctctgcatatcg
ggctcttcggccgaattgggaaattgggatgaagcacttgccttggagctgacagcaacg
ggcgaggacagatgggagggacgtgtgatcatagacggtcgccgcaaggatatacagtat
tactatctggtaagagacgccgaaggcaacgccattcgcaaggagtggaaacgcatgcac
catctggtattggatcatggttacaagcgagtgctgatggacgattactggatcgatcga
ccgaaaaatgcaccctttttcagttctgctttttacgatgttttcttccgccatgaggag
aagctgaaacgtgccccgaaaccaacgaaggagggcgtcaaagtcgtcatgcagctatat
gctccatgcgttcaccccgaccagaagatctgtatgacgggcaatagtcctgctcttggc
aactggtcagtggagcaagcccgcgccatgcaccatttgggaaagggcgaatggtctatc
acgctggagaaggatgaattacctccacttttggaatataagtttttcattgccggacaa
gacgactgctccgacatccgttgggaagagggagaaaacagatcttaccgattcgaagag
acggatgcctatggtgccgtctatttggccggcctctgtttccgcgagggtgattatatg
ccacgctatgcaggtagcgtcatccctctattcggactgcgcacccacaaggattggggc
ataggagacttcggtgcactccgccgtatggtggactgggcggcaatgaccggccagcgc
attatacagctcctgcccatcaacgacaccacttacacacgctcctatcgcgactcctat
ccatataatatagtatcggtcatcgccatccatcctatctatgccgatttggatgcgctg
ccacgactgaagaatagtgctctgatggcaaaaatggagaagcaggccgaagcactgagg
gcactcaagcaaatggattatccggctgtgttggctctgaaggaggaatttctgcatgcc
ctgtatcgacaggaaggggcgaatgtgatgcgcaagaaagctttccgtcaattcgtctca
gcagcggctgattggttggatccatatgcggctttttgccatctgcgcgacaagtacgag
ggactgccactccatctgtggcctgaatatacgtgggggaaaaaccaaatcgaacgaatg
gcggtatctcccgaactgaaaacggagaccaattactatcgcttcgtacaatttttactc
cacgagcagctgcatgccgtatcggcctatgccgaagaaaaagggatcctactcaaagga
gatataccgatcggagtcagccccaatagtgtggaggtgtggatggaaccgtccctgttc
gacacggagcatgccgccggatcacctccggatcagttttccgagaatgggcaaaactgg
ggtttccctatctaccgatgggacgtaatgagtcgaaacggctttgcctggtggcgcaag
cgtttcgagagcatggccgactacttcaaggctttccgcatagatcatatattgggcttt
ttccgtatatgggaaatccctgtcaagcatgtttcgggcttgttgggacatttcaatcca
gctatagccatgaccgaaaaggagataaaggagtacggcttcccgttcgatgcccgattc
tgctcccttccgctcgttcatgcagatgacctcaagcagattttcggacgctatgcaagc
gaagtatgctgtcgataccttcgtccgttcgattcggattattatacgctggcgacgaag
aatttctatcagaccgatatagcagcgttagatcctacagccgttgtcggaggagaggac
acgatcagaggtttgatgcgtgtagccacagaagtatgtttcgtaatagaatcaggcaag
cccggggccttccacccacgcatccatttcgaaaagtcttttcgctatgctcatctgagc
ttggaggaaaagaaagcttggcagcatctgtcggacgactacttctacaagcggaacgat
gacctgtggaagcaagaggcactgtcgcggctgataccgctgctttcctccacggatatg
ctcgtctgtgtagaggatctgggaatgataccccctgcggtgcctgtcgtaatggaacag
ttgcaactgctatccctcattttggaaagaatatccaaagagccgggacaggactttgcc
gatatgagtcggcagccctattgttcggtatgtaccacctccacgcacgacatggcgcct
ctgcgtctttggtggcaggagaacgaactgcttcgccggcactactattccatgatcctc
ggagagaaaggtactgcaccggagacatgtacgccggagacggctcgccgaatccttcgg
cagcatctgctgtccacttccatgctggctattttcccattagctgattggctgtcgcta
tcgggtgagttgcaaggaattgttgcgcccgaggacgaacagatcaacaaaccggagatt
tccgatcactactggcgttatcggatgcctatttctatcgaaagcctttctgaagactat
cgggagctgaacgaatcaatagcctccctcattcgcacctcaggcagaggataa

DBGET integrated database retrieval system