KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0816Help
Entry
PGN_0816          CDS       T00714                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00010  Glycolysis / Gluconeogenesis
pgn00030  Pentose phosphate pathway
pgn00051  Fructose and mannose metabolism
pgn00680  Methane metabolism
pgn01100  Metabolic pathways
pgn01110  Biosynthesis of secondary metabolites
pgn01120  Microbial metabolism in diverse environments
pgn01130  Biosynthesis of antibiotics
pgn01200  Carbon metabolism
Module
pgn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGN_0816
   00030 Pentose phosphate pathway
    PGN_0816
   00051 Fructose and mannose metabolism
    PGN_0816
  Energy metabolism
   00680 Methane metabolism
    PGN_0816
Enzymes [BR:pgn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PGN_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 DUF1084
Motif
Other DBs
NCBI-ProteinID: BAG33335
UniProt: B2RIZ0
Position
896282..898279
Genome map
AA seq 665 aa AA seqDB search
MANDKTQTVQMLKHDLDYLELLSESFPTATEVATEIINLEAILNLPKGTEHFLADIHGEY
EAFIHVLKNASGSIRRKVDEVFGGQLRQNQKRELCTLIYYPREKLELVKQSDERMEDWYM
VTLNQLIKVCQKAAEKYTRSKVRKTLPPKYSYIIQELLHEDGVNPNKSAYISSIFSSIIS
TGCADDFIIAISETIQRLVIDHLHVVGDVFDRGPGAHIIMDTLMKYHHFDIQWGNHDMLW
MGAAVGNASCMANVVRIALRYANLDTLESGYGINLLPLARFAMDTYADDPCTVFKPKLAQ
ADQTYDDKSVYLISQMHKAISIIQFKLEHQIIARHPEYKMDNRDLFHLVNFTDGTIKLSS
GVYPMLDMNFPTVDPADPYALTEQEQNIVDRLMGCFMRSEKLQNHLKCLYRHGSMYLTYN
MNLLYHASIPLNKDKSLKKVRVGDKTYAGRELLDKVEEMIRTAYVAPEKSDQRLAAVDYM
WYLWCGPDSPLFDKAMMTTFERYFIEDKATHHEEKGYYYVYRQEKAVCEMILKEFGLEGP
DTHIINGHVPVKAKKGELPIGAEGKLMLIDGGFSKAYQSSTGIAGYTLIFNSQGLHLVQH
EPFSSTRKAIEEMEDIKSITVVREVTSHRMLVKDTDNGHLLSKQVENLKKLLQAYSYGLI
KERKK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgataagacgcagaccgtgcagatgctcaagcacgatttggactatttggaa
ttgctctcggagagtttcccgacagcgacggaagtagctacggagattatcaatcttgaa
gctatattgaatctgcctaaaggaacagaacacttcctggcggacattcacggcgaatac
gaagcctttatccatgtgctcaagaatgcttccggtagtattcggagaaaggtagacgag
gtcttcggcggtcagttgcgccagaatcagaagcgagagctgtgcaccctgatctattat
cctcgcgagaaactcgaactcgtgaagcaaagtgatgagcggatggaggactggtatatg
gtcacgctgaatcagctgatcaaagtgtgtcagaaagctgcagagaaatatactcgctcc
aaggtacgtaagacccttcctcccaagtacagctatatcattcaggagctactccacgaa
gatggtgtcaatcccaataaatcggcttatatcagcagcatcttttcctctataatatcc
acagggtgtgccgatgactttatcattgccattagtgagaccatccagcggctggtcatc
gaccatctgcacgtggtaggggatgtcttcgaccgtggccccggagcacatatcatcatg
gatacccttatgaagtatcatcatttcgatatacagtggggcaatcatgacatgctgtgg
atgggagctgctgtgggcaatgcctcttgtatggccaatgtggtgcgtatagcactgcgc
tatgccaatttggatacattggagagcggatacggtattaacttgttgcctttggcgcgt
ttcgccatggacacttatgcggacgatccctgtaccgtatttaagcccaaactggctcag
gccgaccagacgtatgatgacaagagcgtctatctgatcagtcagatgcacaaagccata
tctatcattcagttcaagctggagcaccagatcatagcccgtcatccggagtacaagatg
gacaatcgggatttgttccatctggtgaacttcaccgatggtaccatcaagctgtcgagt
ggcgtatatccgatgttggatatgaatttcccgaccgtggatccggccgatccgtatgca
ctgacagagcaagagcagaatatcgtagatcgtctgatgggctgttttatgcggagtgaa
aaactgcaaaaccatctcaaatgcctctatcgtcatggcagtatgtacctgacgtataat
atgaatctgctctaccatgcttctatccctctgaacaaggataagtcgctcaagaaagta
cgggtaggggacaagacctatgccggacgcgaattgctcgacaaggtggaagagatgatc
cgtaccgcatatgtggctcccgagaaaagcgatcagagacttgcggctgtggactacatg
tggtacctctggtgcggaccggattctcctcttttcgacaaagctatgatgactactttc
gagcgttacttcatcgaagataaggctacgcatcatgaggaaaagggttactactacgtc
tatcgtcaggagaaagccgtttgtgagatgatcctcaaagagtttgggcttgaaggtcct
gatacgcatataatcaacgggcacgttccggtgaaggccaagaaaggggagcttcctatc
ggagctgaaggcaaactgatgttgatagatggcggattcagcaaggcatatcagtcaagt
acggggatcgccgggtatacgctgatatttaactctcagggattgcatcttgtacagcac
gaaccgtttagttccacacgcaaggctatcgaagagatggaggacatcaagagtatcacg
gtggtgcgtgaggtcacatcccatcgtatgctggtaaaggatacggacaatggccacttg
ctgagcaagcaggttgaaaacctcaaaaaactccttcaggcgtacagctacggactgatc
aaggaacgaaaaaaatag

DBGET integrated database retrieval system