KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0816Help
Entry
PGN_0816          CDS       T00714                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGN_0816
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGN_0816
   00030 Pentose phosphate pathway
    PGN_0816
   00051 Fructose and mannose metabolism
    PGN_0816
  Energy metabolism
   00680 Methane metabolism
    PGN_0816
Enzymes [BR:pgn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PGN_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
896282..898279
Genome map
AA seq 665 aa AA seqDB search
MANDKTQTVQMLKHDLDYLELLSESFPTATEVATEIINLEAILNLPKGTEHFLADIHGEY
EAFIHVLKNASGSIRRKVDEVFGGQLRQNQKRELCTLIYYPREKLELVKQSDERMEDWYM
VTLNQLIKVCQKAAEKYTRSKVRKTLPPKYSYIIQELLHEDGVNPNKSAYISSIFSSIIS
TGCADDFIIAISETIQRLVIDHLHVVGDVFDRGPGAHIIMDTLMKYHHFDIQWGNHDMLW
MGAAVGNASCMANVVRIALRYANLDTLESGYGINLLPLARFAMDTYADDPCTVFKPKLAQ
ADQTYDDKSVYLISQMHKAISIIQFKLEHQIIARHPEYKMDNRDLFHLVNFTDGTIKLSS
GVYPMLDMNFPTVDPADPYALTEQEQNIVDRLMGCFMRSEKLQNHLKCLYRHGSMYLTYN
MNLLYHASIPLNKDKSLKKVRVGDKTYAGRELLDKVEEMIRTAYVAPEKSDQRLAAVDYM
WYLWCGPDSPLFDKAMMTTFERYFIEDKATHHEEKGYYYVYRQEKAVCEMILKEFGLEGP
DTHIINGHVPVKAKKGELPIGAEGKLMLIDGGFSKAYQSSTGIAGYTLIFNSQGLHLVQH
EPFSSTRKAIEEMEDIKSITVVREVTSHRMLVKDTDNGHLLSKQVENLKKLLQAYSYGLI
KERKK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgataagacgcagaccgtgcagatgctcaagcacgatttggactatttggaa
ttgctctcggagagtttcccgacagcgacggaagtagctacggagattatcaatcttgaa
gctatattgaatctgcctaaaggaacagaacacttcctggcggacattcacggcgaatac
gaagcctttatccatgtgctcaagaatgcttccggtagtattcggagaaaggtagacgag
gtcttcggcggtcagttgcgccagaatcagaagcgagagctgtgcaccctgatctattat
cctcgcgagaaactcgaactcgtgaagcaaagtgatgagcggatggaggactggtatatg
gtcacgctgaatcagctgatcaaagtgtgtcagaaagctgcagagaaatatactcgctcc
aaggtacgtaagacccttcctcccaagtacagctatatcattcaggagctactccacgaa
gatggtgtcaatcccaataaatcggcttatatcagcagcatcttttcctctataatatcc
acagggtgtgccgatgactttatcattgccattagtgagaccatccagcggctggtcatc
gaccatctgcacgtggtaggggatgtcttcgaccgtggccccggagcacatatcatcatg
gatacccttatgaagtatcatcatttcgatatacagtggggcaatcatgacatgctgtgg
atgggagctgctgtgggcaatgcctcttgtatggccaatgtggtgcgtatagcactgcgc
tatgccaatttggatacattggagagcggatacggtattaacttgttgcctttggcgcgt
ttcgccatggacacttatgcggacgatccctgtaccgtatttaagcccaaactggctcag
gccgaccagacgtatgatgacaagagcgtctatctgatcagtcagatgcacaaagccata
tctatcattcagttcaagctggagcaccagatcatagcccgtcatccggagtacaagatg
gacaatcgggatttgttccatctggtgaacttcaccgatggtaccatcaagctgtcgagt
ggcgtatatccgatgttggatatgaatttcccgaccgtggatccggccgatccgtatgca
ctgacagagcaagagcagaatatcgtagatcgtctgatgggctgttttatgcggagtgaa
aaactgcaaaaccatctcaaatgcctctatcgtcatggcagtatgtacctgacgtataat
atgaatctgctctaccatgcttctatccctctgaacaaggataagtcgctcaagaaagta
cgggtaggggacaagacctatgccggacgcgaattgctcgacaaggtggaagagatgatc
cgtaccgcatatgtggctcccgagaaaagcgatcagagacttgcggctgtggactacatg
tggtacctctggtgcggaccggattctcctcttttcgacaaagctatgatgactactttc
gagcgttacttcatcgaagataaggctacgcatcatgaggaaaagggttactactacgtc
tatcgtcaggagaaagccgtttgtgagatgatcctcaaagagtttgggcttgaaggtcct
gatacgcatataatcaacgggcacgttccggtgaaggccaagaaaggggagcttcctatc
ggagctgaaggcaaactgatgttgatagatggcggattcagcaaggcatatcagtcaagt
acggggatcgccgggtatacgctgatatttaactctcagggattgcatcttgtacagcac
gaaccgtttagttccacacgcaaggctatcgaagagatggaggacatcaagagtatcacg
gtggtgcgtgaggtcacatcccatcgtatgctggtaaaggatacggacaatggccacttg
ctgagcaagcaggttgaaaacctcaaaaaactccttcaggcgtacagctacggactgatc
aaggaacgaaaaaaatag

DBGET integrated database retrieval system