KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1012Help
Entry
PGN_1012          CDS       T00714                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGN_1012
Enzymes [BR:pgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PGN_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1124385..1125209
Genome map
AA seq 274 aa AA seqDB search
MIVFPNAKINLGLQVVAKRADGYHNIETVFYPIPLTDALEIEVREDTCDRLSVHGIPIDA
ATEDNLVMKAILALRRKFDFPPLTIELIKHIPSGAGLGGGSSNASFMLKLVRDYFSLPID
DKELAAIALTIGADCPFFVGNRPVLATDLGQVFTPLPNFSLSGLHIAIVKPPIHINTAAA
YKGLKHVGKRETMPDEIVYMPVDEWRGKLVNDFEESLFPEHPRLAELKEMLYRSGALYAA
MSGSGSALFGLFREKPQLDKAAITDCFRWQSIIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttttcccaatgcaaaaatcaacctcggcttgcaggttgtagccaagcgagcg
gacggctaccacaacatcgagacagtcttctatccgatcccgctgaccgatgctttggag
atcgaagtacgagaggatacttgcgaccgtctttccgtccatggcattcccattgatgct
gcaacggaggacaatttggtcatgaaagcgatcttggctcttcgccgaaaatttgatttt
cccccactgactatcgagcttatcaagcacattccgtcaggagcaggcttgggaggaggt
tcttcgaatgcgtctttcatgctgaagttggtgagggactatttctctctaccgatcgat
gacaaagaattggcggcaatagcactgacgatcggtgccgattgtccttttttcgtagga
aatcggccggtattggccaccgaccttggccaagtctttactccgctacccaatttttct
ctgtccggtctccatatcgctatagtaaaaccacccatccatatcaacacagcagctgca
tacaaaggtctcaagcatgtgggcaaacgagagacaatgccggatgagattgtttacatg
cccgtagatgaatggagagggaaattggtgaatgatttcgaagaaagccttttccctgaa
catcctcgacttgccgaactaaaagaaatgctctatcggtcgggggctttgtacgctgca
atgtccggttccggatctgcactattcggtcttttccgggaaaagcctcagctcgataag
gctgctatcaccgactgcttccgatggcaaagcatcatcccctga

DBGET integrated database retrieval system