KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1049Help
Entry
PGN_1049          CDS       T00714                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgn00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pgn00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pgn02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1168010..1169701)
Genome map
AA seq 563 aa AA seqDB search
MKRIKQTLSTILLFIIVLSPALYAGQPREVKPVRNVILMIPDGTSLSAVSLARWYQRYLN
PDRRHLAIDPYICGTVLTYSSDAPIGDSAPTTSCYMTGMPSNTGFVSTYPVSSGDADLIP
VDKARAYSPLATFLEAAKIMKGKKTGLVVTCHFPHATPADCSAHSYSRKKYDWIAAQMVH
QNLDVVLGGGTHYLHPELQSVLNSRGYGLFLDDLNGMRTYAGDKMWALFGKREMPYDLDR
DTTQIPSLEEMTRLAIEKLNRSEEGFFLMVEGSKVDWAAHANDPVGIATEYLAFDRACAV
AFDFAHRDGQTAVIIVPDHGNSGVSIGKQSVKDYDKRSAKDLFDQLCRFRLTADGLAERL
ADTPADKVQGLVSNICGFELDSKELEALYNCPDYNHSPIPKEQRRQTEESLYSGSLSTFI
ASLYTKHTSIGFTTHGHTAEEVLLAAYHPQDTRPMGMVINYELNDYLCRLFELGGQLPVL
TDKIFAPHSEVFQGMSYSIKDGKKEGELPVLEVKKGSHRLLASPFSNTVIFNKKAIDLSS
VVVYVDKTKTFYLPRELRSLFGE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcaaacaaactcttagtacgattcttctttttattatcgtactctctccg
gctctatatgccggtcagccacgggaggtcaagccagttcggaacgtgattctgatgatt
cccgatggtacctctctttcggctgtttctctggctcgctggtatcagcgatacctgaat
cccgaccgccggcatttggctatagatccatatatatgtggtactgttctgacctattcg
tccgatgccccgattggagactctgctcctactacatcgtgctatatgacaggtatgcca
tccaatacgggttttgtgtcgacttatcctgtcagttcgggtgatgcagatctgattccg
gtggataaggctcgtgcttattctcctttggctacttttctggaggcggctaaaataatg
aagggaaagaaaacgggtttggtcgtgacttgtcacttccctcatgccacaccggccgat
tgctcggcacactcttattctcgtaagaaatacgattggattgcagcgcagatggtacac
caaaatctggatgttgtactcggaggcggaacgcactacctccatccggaactgcaatcc
gtactcaatagccgtggctatgggctctttctggatgacctgaatggaatgcgcacttat
gcgggagataagatgtgggctttgttcggcaaacgagaaatgccctatgatttggatcgt
gatactacacaaatcccttcactggaggagatgactcgcttggctatagagaagctgaat
cgttctgaggaaggctttttccttatggtcgagggtagtaaagtggattgggctgcacat
gccaacgatcctgtggggattgctaccgaatatcttgctttcgatcgtgcttgtgccgtg
gcattcgattttgcccatcgtgacggacaaacggctgtcatcatcgtgccggatcatggc
aatagcggtgtaagtataggcaaacaaagtgtgaaagactatgataagcgttctgcaaaa
gaccttttcgatcaactctgtcgcttccgcctgacagcagacggacttgcagagcgtttg
gctgatactcccgccgacaaggttcagggtttggtaagcaatatctgcggattcgaattg
gactccaaagagttggaagctctttataattgtccggattataatcatagtcctatcccc
aaagagcagcgcaggcagacggaagaatccctctacagcggttcgctcagtaccttcatc
gcatcgctttatacgaagcacacttcgatcggttttacgacgcacggacatactgccgaa
gaagtattgttggcggcctatcacccccaagatacacgcccgatgggaatggtcataaac
tatgaactgaatgactatctctgccgtctcttcgaattaggaggccaattgcccgtcctt
accgacaagatatttgctccccattcggaagtattccaaggcatgagctacagtatcaaa
gacggaaagaaggaaggagaactgcctgtccttgaagtgaaaaaaggtagccatcgctta
ctggcgagtcctttctccaatacggttatcttcaataagaaagcgattgatctgtcttcc
gtagtagtctatgtagataagaccaagactttctatttgcctcgtgaactacgttcttta
ttcggagagtaa

DBGET integrated database retrieval system