KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1151Help
Entry
PGN_1151          CDS       T00714                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGN_1151
Enzymes [BR:pgn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PGN_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1280014..1281171)
Genome map
AA seq 385 aa AA seqDB search
MKKNIAILGSTGSIGTQTLDIIHLNPDLFDVYLLTANNNVDLLIRQAREYRPEIVVIAND
QKYHLIQEALADLPIKVWCGAEAIADAVTAPDIDMVVTAMVGYSGLLPTIKAIEARKMIA
LANKETLVVAGELIMRLAQDNQVPILPVDSEHSAIFQALLGERQRPEKILLTASGGPFLH
LTAEELQHATREQALRHPNWNMGAKVTIDSASLMNKGFEMIEAKWLFEMQPDEIEILVHP
QSIIHSMVQFRDGSVKAQLGIPDMRLPISYALGITHRIPNDYPRVDFTATPLTFERPDLE
RFPNLSYAFDAIRLGGNAPCALNAANEIAVTAFLRDEISFTDMSRLLYEVMEKHELFREV
SLPTFIETDSNTRRVAESLLPKFRR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaacatagccatccttggctcgaccggatccatcggtacacagacactcgat
attatccatctgaatccggatcttttcgatgtctacctccttacggcaaacaataatgta
gaccttttgatccgacaggcacgcgaatatcggccggaaatagtcgtaatagccaacgac
caaaaataccatcttatacaagaggctttggccgatttgcctatcaaggtatggtgtgga
gccgaggctattgccgatgcggtaacggctccggatatcgatatggtcgtgacggccatg
gtaggctattcggggttgttgcctacgatcaaagccatcgaagcccgaaagatgatagca
cttgcaaacaaagaaactctcgttgtggcaggcgaactcatcatgcgattggcgcaagac
aatcaggtacctatccttccggtcgattcggagcattcggctatttttcaggctctttta
ggagagagacagcggccggagaagatcctgctgacggcttcgggaggcccttttctgcat
ctgacagcagaggaattacagcatgccacccgtgaacaggctctccgccatcctaattgg
aatatgggggcaaaggtgactatcgattctgcttcgctcatgaacaaggggtttgagatg
attgaagccaaatggttgtttgagatgcaacccgatgagatcgaaatactcgtgcaccca
caaagcataatacactccatggtgcagttccgcgatggttcggtcaaggctcaacttggt
attcccgatatgcgtttgcctatcagttatgcccttggcattacccaccgcatcccgaac
gattatcctcgggtggatttcacggctacccccctgaccttcgaacgccctgatctcgaa
cgattccccaatctctcttacgcttttgatgcgattcgtttgggtggcaatgcaccttgt
gcactcaacgctgccaatgagattgccgtgactgctttcttgcgcgatgaaatttctttt
acggatatgagccgtctgttgtatgaagtgatggaaaagcacgaattgttccgagaagta
tctttgcccactttcatcgagacggacagcaacacacgccgagtggccgaatcccttctg
cccaaatttcgtcggtaa

DBGET integrated database retrieval system