KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1286Help
Entry
PGN_1286          CDS       T00714                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1433029..1433544
Genome map
AA seq 171 aa AA seqDB search
MGTRSKLLVLSFCLVCLSCFRLFAQEGGKALFSLPPFERAVVCIKHFEGLHSWKDYPYVG
YGHRLLPCEHFTAAMTERQADSLLRVDLMKRLMMFKDYGKDALLLAVLSYNVGTGRLLGY
GKHPKSRLLRKIESGNRNFYREFVSFCRYKGKVLRGLVKRRKVEFALFYIP
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggggacaagaagtaaacttctcgttttatcgttctgccttgtttgcctatcctgcttc
cgccttttcgctcaggagggcggaaaggctctcttttcactaccgccgttcgagcgtgcc
gttgtctgcatcaaacacttcgagggcttacattcttggaaggattatccctatgtaggc
tatggacatcggcttctgccctgtgaacacttcacggcagcaatgacggaacggcaggcg
gactctctgctccgtgtagacctgatgaagcgtctgatgatgttcaaggactacggaaag
gatgccctgctgcttgccgttctgtcctacaacgttggaacgggcaggttgctgggatat
ggtaaacaccccaaaagccgattgctgcggaagatagagtcgggcaacaggaatttctac
cgcgaatttgtctctttctgccgatacaagggcaaagtcctcagaggtcttgtcaaacga
cgaaaagtggagttcgctctgttttatataccctga

DBGET integrated database retrieval system