KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1772Help
Entry
PGN_1772          CDS       T00714                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGN_1772
Enzymes [BR:pgn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PGN_1772
Exosome [BR:pgn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGN_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1988924..1990930)
Genome map
AA seq 668 aa AA seqDB search
MRIIEQDPWLRPYESVIESRLKYARKRETDLTGGRSGGLSNFANGHLYYGLHQDGDSWVI
REFAPEATAVYLIGELSRWRRLPQFRFAPVDEAGSWELRLPCRLLPHGSRYRLFFEWPGG
EGERIPAWCNRVEQDPETYLFYAQVWVPDTPYEMKHPHPNRKDEPLLIYECHIGMSSEEE
KVSTYEEFRRNILPRICKDGYNAIQLMAIQEHPYYASFGYHVSSFFAPSSRFGTPEDLKR
LIDEAHALGLYVIMDLVHSHAVKNEVEGLGLYDGTHTLFFHEGNRGLHPAWDSYCFDYGK
DNVLHFLLSNCKYWLTEFGFDGFRFDGVTSMLYYSHGLGDRFDNYDSYYNGHQDGDAIAY
LILANKLIHELCPDAITIAEEVSGMPGLALPLADGGYGFDYRLAMNIPDFWIKLIKEHRD
EDWNPGDIWYQLTNRRQEEKTISYAESHDQALVGDKTIIFRLINADMYWYMNKQSCVHSV
DRGIALLKMIRLFTATTMNGGYLNFMGNEFGHPEWIDFPREGNGWSYKYARRQWSLADSP
FLRYAGLHLFDQDMIAMIRSVESFHKLPLREYWLKREEQVICYGRGNFFFVFNFHPERSY
SDYPIPLPAGKYSVAMSTDARKYEGFGRVDEWVEHFTLPDGSKDRFTHEQYLNLYLPARS
ALILKFTE
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgagaataatcgaacaagatccttggctgcgcccatatgaatcagtaatagaaagcaga
ctgaagtatgctcgcaaacgagagacggatttgaccggaggaagatccggcggattgagc
aacttcgccaatggacatctctattacggtcttcatcaggacggggattcgtgggtgatt
cgtgagttcgcgcccgaagccacggccgtatatctgatcggcgaactttcgcgctggcgt
agattgccacagtttcggtttgcgcctgtggatgaagcgggttcatgggaattgcgactt
ccatgccgactgcttccgcatggctctcgctacaggctcttcttcgaatggcccggtggc
gaaggagagaggataccggcttggtgcaaccgtgtagaacaggatcctgaaacttatctt
ttctacgcccaagtgtgggtgccggatactccctatgaaatgaaacaccctcatcctaac
cgtaaggacgagcctttgctaatttatgaatgtcatatcgggatgtcgtccgaggaggag
aaggtcagcacatacgaagagtttcgacggaatatcctcccccgtatctgcaaggacggc
tataatgccatacagctcatggcgatacaggagcatccttattacgcgtcgttcggctat
catgtgtcgagtttctttgctccgagcagtcgttttggaacgcccgaagatctcaagcgt
ctgattgatgaagcccacgctctcggcctctacgtgatcatggatctggtgcattcgcat
gcagtcaagaacgaggtcgaaggcttgggcttgtatgacggcacgcatacccttttcttc
catgaaggcaatcgcggactccatccggcttgggattcgtattgcttcgactatggtaag
gacaacgtactgcacttcctcctttccaactgcaaatactggctgacagagtttggattc
gacggcttccgtttcgatggtgtgacgtccatgctatactatagtcatggactcggtgat
aggttcgacaattacgacagctattacaacggccatcaggacggcgatgctattgcctat
ctgatcttggccaacaaactcattcacgaactttgccccgatgcaatcacgatagccgaa
gaggtaagcggcatgcccggattagctcttcccttggcagatgggggatatggctttgac
taccgtttagccatgaatatccccgatttctggatcaagctcatcaaagagcatcgagac
gaagactggaatcccggcgacatctggtatcaactgaccaatcgccgtcaggaggaaaag
acgatcagctatgccgagagtcatgatcaggctttggtcggggacaagacaatcatattt
cgcctgatcaatgccgatatgtattggtatatgaacaagcagagttgtgtacatagcgtg
gacagaggcattgcactgctgaagatgatccgtctcttcactgccacgacgatgaatggt
ggttatctcaatttcatgggcaatgaattcggacatcccgagtggatagacttccctcgc
gaagggaatggctggtcgtacaagtatgcccgcaggcagtggagtctggccgatagtcct
ttcttgcgctatgcaggtctgcacttgtttgatcaggatatgatagccatgatacgatcg
gtggagagctttcacaaactcccattgcgcgaatactggctcaagagagaagagcaggtg
atctgttacggtcgaggcaatttcttcttcgttttcaattttcaccccgaacgttcttat
tcggattatcccatccctcttccggccggtaagtattcggtagcgatgagtaccgatgca
cggaagtacgaaggtttcggtcgtgtggacgaatgggtggagcattttactcttccggat
gggagtaaagatcggtttacccatgaacagtatttgaacctctatctgccggctcgctct
gctctcatcctgaagtttaccgaatga

DBGET integrated database retrieval system