KEGG   Porphyromonas gingivalis ATCC 33277: PGN_2032Help
Entry
PGN_2032          CDS       T00714                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PGN_2032
  Lipid metabolism
   00561 Glycerolipid metabolism
    PGN_2032
   00600 Sphingolipid metabolism
    PGN_2032
Enzymes [BR:pgn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PGN_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2275159..2276604
Genome map
AA seq 481 aa AA seqDB search
MKRCAFSLFGRPTGFLLILLLAFPALYALSPTEGSPRILLPGRSIWPMDREWTFKIPYLG
SRPTHWAIKRLPEGFTFDSHEGIIRGRASSRIVFEFEISAANESGADSCIWQVEVSRYNG
LAPVMGWSTRWLKEKEINEQTILDVADAMQSKGLVAAGYNHIIIESHWQTSVRDSDGRIK
ADPLRFPNGIKHLADELHRRGMRLGLSSNASPLNVHGLSGSFEKEAIDAATFSEWGVDFI
KYDYCCSPPISIVAQQRYGAMGRALAATGRPPFFSVCEWGELMPWSWGVTVRAGSWRTSF
DIQDKWKAGRYSKRDNGIWDAAMINLRYAQHANRGRAISDPDLLLIGSPSNGCTAEEYHA
QMQMWAMMRAPLVFAADPRSVSAEAVALLTHPDLIAVDQDASFRNIVEERRADGTHLWTR
QLTKGTAVLVVNTGESPTTTSIVSRPDSSSAWDVSRAAYVSPSDLERIVLSPHAARLFIF
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggtgcgctttctctctgttcggaagaccgacaggctttcttctgattctcctt
ctcgcatttcctgctctctatgcactgagtccgacagagggtagtccgcgtattcttttg
cccggacgatctatttggcccatggatcgggaatggaccttcaagataccttatctggga
tcacgccccacgcattgggctatcaagcgtttgcccgaaggattcacattcgattcccac
gaaggaattattcgcggtagggcttcttctcgcatcgtattcgaatttgaaatatcggca
gccaacgaatcgggtgccgacagttgcatttggcaagtggaagtgagtcggtataatgga
ttggctcccgttatgggttggagtacacgttggctgaaggagaaagaaataaacgagcag
actattttggatgtggccgatgcgatgcaaagtaaaggactggttgcagccggatataac
catatcatcatagaaagccactggcaaacgtccgtacgtgacagcgacgggagaattaag
gcggatcctttacgtttccccaatgggatcaaacatttggccgatgaactgcatcgtcgc
ggtatgcggctcggcctttcctccaatgcatctcctcttaacgttcatggcttgagtggt
agttttgagaaagaggcgatagatgccgccacattctccgagtggggtgtggattttatc
aaatacgactactgctgttcaccgcctatatccatcgttgcgcagcaacggtatggtgcc
atggggcgcgcacttgcggcaacgggacgtcctccgttcttctccgtatgcgaatggggt
gaattgatgccctggtcttggggcgtaacggtgcgtgccggcagttggcgtacctctttc
gacattcaagacaagtggaaagctggtcgatattctaaacgcgacaatggtatttgggat
gcagcaatgatcaatttgcgctacgctcagcatgccaatcgtggccgcgcgatctccgat
ccggatctgctattgataggaagcccctccaacggttgtacagcggaagaataccatgca
caaatgcaaatgtgggcgatgatgcgcgctccgctggtctttgctgccgatccgcgctcc
gtatcggcggaggcggtagcactgctgacgcatcccgatctgattgcagttgatcaggat
gcttctttccgtaatatcgtggaggaacgtcgtgctgacggtacacatttgtggacacgt
cagctgacgaaaggaacggccgtcttggttgtgaatacaggagaaagcccgacgacaacg
agcatcgtttcacgccccgactcatcatctgcgtgggacgtatcgcgagctgcttatgtg
tcgccgagcgacttggaacgaatcgtcctgtcgccgcacgcagcccgactgtttattttc
gaataa

DBGET integrated database retrieval system