KEGG   Porphyromonas gingivalis ATCC 33277: PGN_2061Help
Entry
PGN_2061          CDS       T00714                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pgn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2312835..2313323)
Genome map
AA seq 162 aa AA seqDB search
MISIVVAIAENGAIGYKNDLLWHLPADLKRFKEMTTGHSIIMGSRTFRSLPKGALSNRRN
IVLSRTQQDFPGAEWAASPEVALELVGEEAEAFVIGGAQVYEQMLPYTDKIYLTRVHADF
PEADTFFPELDMSEWVELSRTEYLADEKNRYATTLLELIRDY
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaatcgttgttgccatagccgagaatggggctatcggatacaaaaatgacctc
ctctggcatctgccggccgatctcaaacgattcaaggaaatgaccacagggcatagcatt
atcatgggtagccgtacattccgctccctgcccaaaggtgctttgtccaacagacgcaat
atcgtcctaagcaggacgcagcaggattttcccggtgccgaatgggcagcttcgcccgaa
gtggcattggagctggtgggcgaagaggcagaggcctttgtcatcggcggagcacaagta
tatgagcagatgctgccctacacggacaaaatctatctgacacgcgtgcatgccgacttt
cccgaagccgacactttttttcctgaattggacatgagcgaatgggtggagctgagccgc
acggaatatctggccgacgagaaaaaccgatatgccaccactctgctggagcttatccgc
gattattga

DBGET integrated database retrieval system