KEGG   Puccinia graminis: PGTG_00062Help
Entry
PGTG_00062        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pgr  Puccinia graminis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MRWLPLESNPEVMNAWSSALGLSTDQVSFTDVYGLDAELLAMVPKPVYAVLMLFPISKEY
EAARAAEHARIVDQAGGALKSDERLIFIKQTISNACGTIGLLHALANNSEIPITEGPLTK
FLEQCRAKSPSERAQLLEDDCAIADVHADQAQSGQSKVPSSDEEVNLHFVCFVKKIAQPD
RPEAEPARLVELDGRKAFPIDHGPIAPSQDLLEAVVPVVKQFIQLSQDNVNFNLIALCQN
SA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggctcccgttagaatccaatccggaggtgatgaatgcctggtcatcagctcta
ggcctgtcgaccgaccaagtgagcttcacggacgtctacggactcgacgcggaactactg
gcgatggtccccaagccggtctatgcggttctaatgcttttcccgatctcgaaggagtac
gaggcggcacgggcggccgaacatgcacggatagtagatcaggccggtggagcgctcaag
tccgacgaacgacttatctttatcaaacagacaatcagcaatgcatgtggcacgatcggc
cttctccacgcgttagccaacaattccgagatcccgatcactgagggaccattgaccaag
ttcttggaacagtgtcgggctaagagcccctctgagcgtgcacagctattggaggatgat
tgtgcgattgctgatgtacatgctgatcaggcacagagcggacaatctaaggttcctagt
tcagatgaagaggtcaacttgcactttgtctgttttgtcaagaagatcgcacagccagac
cgaccagaagcagagcccgcccgattggttgagttagatggccggaaggcgtttccgatc
gaccatggtccgatcgctccgtcacaggatctactcgaagctgtggtaccggtggtcaaa
cagttcattcaactgtctcaggataatgtgaacttcaacctgattgcactctgtcaaaat
tctgcatga

DBGET integrated database retrieval system