KEGG   Puccinia graminis: PGTG_00895Help
Entry
PGTG_00895        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pgr  Puccinia graminis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PGTG_00895
Enzymes [BR:pgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PGTG_00895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 653 aa AA seqDB search
MDCFFKDPRLLKQQQQQKQTTTQQQQQQIRIKTLQTNQQPLPKRIKLNHQQQTATGTNQT
TTTTKKTIHSKPQLNNTQQPDQLSKTRETKPLVNQTEDNHHKTQDINNNNKTQDINQTQD
INKTQDINKTQDINTTQNNNKTQDIKKTQDINKTQNNNKTQDKQHQDDQNQTKKNPTTNH
QDYQLHPIIPRSVDKTITAYSSNHPLNVEPAERKLTSSAKLVNANRSQFKPWFTNQDPQR
WPFKKNQDPQIRVVYPTGAHELFPLLVPKNDLDEYRPLDDLLNVITTTLTYYLTPDQSLH
FFSEPHPITSPSASVPHSQLNDFSFLNRRSQERSSPEPGRSTTPKIPLSDASLDLSSKPL
LKELAKTIRRKNGPEFLGLVGWYNRVIKYLVEGKEIGRQIGSFVGMPQGVWETILGQAYD
RQVGPQLELLQGYETWSSNVYGELKPRFVSEIIRLVGLRPGMVFLDLGSGIGNIVLQVAL
EVGCVAVGFEIMDGCAKLANLQRSELVGRAHSLWGVNLGAPLLFQADFTKDPRVGQWLQQ
ADVVLVNNQVFTPSLNESLSLLFLELKDTAQIVSLKPFISSSFKLNQRNLDSPLAILSRP
ALRPTPPSTLVANSPGVFSYPSNSVSWTDNPGDFFVSVVNRDKLIRFQESCQA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggactgcttcttcaaagacccaagactactcaaacaacaacaacaacaaaagcaaacg
acaacccaacagcaacagcaacagatcagaatcaaaacactacaaacaaaccaacaacca
ctcccaaaaagaatcaaactcaaccaccaacaacagacagccactggcacaaaccaaaca
acaacaaccactaagaagactattcacagtaaaccacaactcaacaacactcagcaaccc
gatcaactcagcaagactcgggaaacgaaacccttagtgaaccagacagaggacaatcat
cacaagacccaggatatcaacaataataacaagacccaggatatcaaccagactcaggac
atcaacaagactcaggatatcaacaagactcaggatatcaacacgactcagaataataac
aagactcaggatatcaaaaagactcaggatatcaacaaaactcagaacaacaacaagact
caggataaacaacaccaagatgatcagaaccagacgaagaagaacccaacgacaaaccac
caggactaccaactccatccgatcatcccacgctccgtcgacaagaccatcaccgcgtac
tcatccaaccatcccctgaatgtcgagccagccgagcgcaaactcaccagctcggccaag
ctggtcaacgccaacaggagccaattcaagccctggttcactaaccaggacccgcagcgc
tggccgttcaagaaaaaccaggacccccagatcagagtcgtctatcctaccggcgcacac
gaactcttccccttactggtgcccaaaaacgatttggatgaatatcgtcctttggatgac
cttctaaacgtcattactaccacacttacctactacctcacacccgaccagtcgctgcat
ttcttctccgagccacatcctatcacttccccctccgcatccgtcccacacagccaactg
aacgacttcagcttcctaaaccgacgttcgcaggagcggtcctcgccggagcccggacga
tcgacgacgcccaagatcccgctctcggacgcatcgttagatctgagctcgaagccgctc
ttgaaagagcttgcgaagacgatccgacggaagaacgggccggagtttctggggctggtt
ggctggtacaatcgggtgatcaagtatctggtcgaagggaaagagatcggccgacagatc
ggctcgtttgtggggatgccgcagggagtctgggagacgattttaggccaagcgtatgac
cgccaggtggggccccaattggagctcttacagggctacgagacctggagcagtaatgtg
tatggcgagctcaagccccggttcgtctcggagatcatccggctcgtcggcctaagaccc
ggcatggtcttcctcgacctcggctccggaatcggtaacatcgtcctccaggtcgccctc
gaggtcggctgcgtcgccgtcggcttcgaaatcatggacggctgcgccaaactcgctaac
cttcaacgctccgaactcgtcggtcgcgctcactccctatggggagttaacctcggcgcc
cctcttctcttccaggctgacttcactaaggatccccgagtgggccaatggctacaacag
gcggatgtcgtactagtgaataaccaagtcttcaccccgagtctgaacgaatcgttaagt
ttgctgttcctggagctgaaagacacggcccagatcgtctcgctgaagccgttcatctcg
agctccttcaagctcaaccaacgcaacctggattccccgttagccatcctctcccgaccc
gccctccggcctactccgccctccaccctcgtcgctaacagtcctggcgtcttcagctat
ccttctaattctgtcagttggactgataaccctggcgacttcttcgtctccgtcgtcaat
cgcgataagttgattcgctttcaagaatcatgtcaggcttga

DBGET integrated database retrieval system