KEGG   Puccinia graminis: PGTG_01098Help
Entry
PGTG_01098        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
pgr  Puccinia graminis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PGTG_01098
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PGTG_01098
   04113 Meiosis - yeast
    PGTG_01098
Protein phosphatases and associated proteins [BR:pgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PGTG_01098
Ubiquitin system [BR:pgr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     PGTG_01098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 975 aa AA seqDB search
MPVNNQTPIRTTTTPNNNNKKQHPSNSLINLLVSIIINLLRSDLIQSALFFSERLHALIP
SSELATWLLSLCLLRSKDYQATVHLLRNAPIFIPNSLPPSSTTTSTKNQQQQQQQQQQQK
PNENNNQKGKGKLADDDPFNFHSSPLAPSKKQPLEFDQNSLKGTTQRPANLASTRCALVY
SKACGLIDRPKEGLEIYLQAIEEFGMSSPDEVALLSSTSNSDQSTSSAYTHLATLSYKSH
EYEKANRFYRKALEATSDGHLCWEAFEGLCQTISTEEDLDPEEIFCLKDVDQFLPGYMEL
DDEYILYTSNASTNTRQPTSLPIVSNAPIKPKPPPLAPKDAFRIMGNNGLYRHKQMLIDN
SFGESSRNSSFAANSFDRPCYAPKPNLPNQRVPQPKSNIISHAKMEMPSTPNLNRPSPLP
PRSFNFALGEPPRHRSDSAYDPVPISSTPNLRHGFEHNHLSSASHPPPMPAPSPLAFTGT
YAKIPCEHPSPLPAMGQQGRGLVSVKRTRSQTQSQDLSRSSTSAPTATTSGELQGHMTNT
QSDGSSKSNLPPVMSTAATTTNTQTAKLGNGRLLSRREMIESGRLMKAVGPRETKRVKSN
SNLFPPPDRQSTPSIAPDRPPTSFPPHTSTSINPAPIFSRFRREKIEAIHWVKDVLQKLA
AAQLALARFNSQVALDSLAALPIEQKRSWRVYCLIGRARFEMLDYKSAEIAFRKARECFP
HLVTHMDIYSTLLWHLRKTTTLSYLSQELQLINPSATETWIATGNLFSRLDDHPNALKCF
QRATQLSRTESYGYTLSGHESLMLSEYSRSLVFFRESIRRNSKTNYNAFFGLGECFYKQD
RFRLALFFFNHARIINPNNPLILAGVAKVYQTLGNLHQALLVFNDAVSLAHSSVASIRFS
RAKILFELGHLEEAKEDLTKLIDLVPTEFNVRFLLGKIYGRLNLKRESIKHLTYAMDLEP
KSIGIVKKILSDLNS
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcaacaaccaaacacccatcagaacaacaacaacaccaaacaacaacaacaag
aaacagcatccatccaactcactcatcaacttactcgtctccatcatcatcaacctactc
agatccgatctcatccaatcagctcttttcttctcagaaagactccatgcactcatccct
tcctcagaactagcaacctggttactctcactctgtctactcagatcgaaggactatcaa
gcaacagtccacctactcaggaacgcacctatcttcatcccaaactcactcccaccctca
tcaacaacaacttcaactaaaaaccaacaacaacaacaacaacaacaacaacaacaaaaa
ccaaatgagaacaataatcagaagggaaaggggaaactggcggatgacgacccattcaac
tttcacagctctccactagcaccatccaagaaacagccactggagttcgatcaaaactca
ctcaaaggtaccacacaacgacccgccaatctggctagtacacgatgtgcactcgtttac
tcaaaagcttgtggcctgatcgatcgtcccaaggaaggattggagatatatttacaagca
atcgaagaatttggaatgtcctctcccgatgaagtcgcgttactcagctccacttccaac
tccgatcaatctacatcatccgcgtacacccacctggccacactgtcatacaagtcacac
gagtatgagaaagccaaccgattctatcggaaggcactcgaggccacctcggatggtcat
ctctgttgggaagccttcgaaggattatgtcagacgatctcgactgaagaggatctagat
cccgaggaaatattctgtttgaaggatgtcgatcagttcctgcctggatacatggaacta
gatgacgagtacatcctctacacctccaacgcctcgaccaataccagacagcccaccagt
cttcccatcgtctccaacgcgcccatcaaacccaaaccaccccctctggcccctaaggac
gcctttcggattatgggcaataatggtctctaccgacacaagcagatgttgatcgacaac
tcatttggcgaaagcagtcggaatagtagctttgctgccaactccttcgatcgcccctgt
tatgctcccaaacccaacctgcccaaccaacgcgtccctcaacctaagtcgaatattatc
agccatgccaagatggagatgccatcgacacccaacctgaatcgccctagccccctgcca
cccaggtcgttcaactttgccctcggagaaccgcctcgacatcgctcggattcggcctac
gatcccgtgccgatctcttcgacccctaatttacgccacggcttcgagcacaaccacttg
agctctgcaagccaccccccgccaatgcctgcgccctcaccactagcattcacaggcacg
tacgcgaaaatcccatgcgagcatccgtcacctttgccggcaatgggtcagcagggccga
ggactggtgagtgtcaaacggacgcgctctcagacccaatctcaggatctctcacgcagc
tcgacgagtgcaccgacggcaacgacgtcaggtgagctacaaggacatatgaccaatacc
cagagcgatgggagctcgaagtcgaacctcccaccagtgatgtcgacagcggcaacgacg
acgaatactcagacggccaagcttggtaacggcagactgttatcgagacgcgagatgatc
gaaagtggacgactaatgaaagctgttggaccccgagaaaccaagcgggtgaagagcaac
agtaacttatttccaccccccgatcggcaatcgacacccagcattgctcccgatcgtcct
cccacatccttccctcctcatacctctacatccatcaatcctgctcctatcttctctcgc
ttcagacgcgagaaaatcgaggctatccattgggtcaaagacgtcctccaaaaactcgcc
gccgctcagctcgcactcgctcgctttaactcccaggtcgcgctcgactccttggccgct
ctccctatcgaacagaaacgtagttggagagtttattgccttatcggtcgggccagattc
gaaatgttggattacaaatccgctgaaatagcgttcagaaaagcccgagaatgtttccca
cacttagtgacacacatggatatatactcgaccttactatggcatttgcgcaagacgacg
acattatcgtacctatcgcaagaactccaactgatcaatccgagtgcaacggagacatgg
atcgcgacagggaacttattcagtcgattagatgaccatccgaatgcgttgaaatgtttc
caaagagcgacgcaactgtcacggacggagtcgtatggatacaccttatcgggacatgaa
agcttgatgctctcggaatattcgcgcagtttggtgttctttcgggagtcgatccgccgg
aattcgaagacgaattataacgcgttcttcggcttgggcgagtgtttttataaacaggat
cggttcagattggccctcttcttcttcaaccatgctaggattatcaaccccaataatccc
ctcatcctcgccggtgttgctaaggtctatcaaaccctgggtaaccttcatcaggccctt
ctcgtctttaatgatgccgtctccctcgcccattcttctgtcgctagtattcgcttctct
agagctaaaatcttgttcgaattaggtcatttagaagaagcaaaagaagatttaaccaaa
ttaatagatctagtccccactgaattcaatgtaagattcttgttaggtaaaatttatggg
agattgaatttgaagagagagtccattaaacatctcacttatgcgatggatctcgaacct
aaatctatcgggatcgttaagaaaatcttgtctgatttaaacagttaa

DBGET integrated database retrieval system