KEGG   Puccinia graminis: PGTG_01227Help
Entry
PGTG_01227        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGTG_01227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MAVTKARSSPRKPRVVITVSCSVGVAFPPSIDTRQVTTTTHIGLCAKSTKESDRSKPQAM
AGEDPERWACDGTGALSLRLARGKVAADQLAPSEQHLISSFHPKFVYPLFGDEETIYGYE
DLDIQLAFNSSTLKNYLAINYAAALPEPDPVEKIIYKFIPPDYTKSEATFNADLESSGTK
KFIPPGKKISSYRTLPSKGKTKSEHFLTSKRWERCTDDQMEDEQDVIYELWAADWKSPGF
REYHRRMQILVLFYIEGGSYIEEDDDRWEFVVLFERRKVKTADGDSSPYSYHFCGYVSLY
SFYHYPSSIRLRLSQFIVLPPYQSNGHGSMLYSQIFQYLLTRPEVAELTLEDPSESFEDL
RDREDLKLLFDNKVFDEKPLSELVPVPSEWYEKTRTKWKLANRQFARLLEMALRWKFTTL
EESDNTKLERLYRIAVKERLYRFNYDSLVDLSKEERREKLQDTFQNVMDDYDRLLRGERR
QID
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacaaaagcgcgaagtagcccccgaaaaccccgagtggtcatcaccgtgtcc
tgctcagttggtgtcgccttccccccttccatcgatacgcgacaagttacaacaaccact
cacattggtctgtgtgcgaaatctaccaaagagtctgatcgatcgaaacctcaagccatg
gcgggagaagatccggaacgatgggcatgcgatggaacaggtgcactttcactccgccta
gctcggggaaaagttgcagccgatcaactcgccccttcagagcagcacctaatctccagt
tttcatccgaagtttgtctatccactttttggagacgaagaaacgatctatggctacgaa
gatctggatatccagctggcgttcaattcatcaacgctgaagaactatctcgcgatcaat
tacgctgccgcgttgcccgaacctgatccagtcgaaaagattatctacaagtttatcccg
ccagattataccaaatcggaggccactttcaacgccgatcttgagtcttccggaacgaag
aaattcataccacctgggaaaaaaatatcttcctatcgcacattaccttccaaggggaaa
acaaaatccgaacatttcctcacttctaaacgttgggaaaggtgtacggatgatcagatg
gaagacgaacaagacgtgatctatgaattatgggccgccgattggaaatctcctgggttt
cgtgagtatcatcggagaatgcagattctcgttttgttctacatcgaaggaggtagttat
atcgaagaggacgacgatcgttgggagtttgttgtcttgttcgagagaaggaaagtgaaa
acagcagacggtgactccagcccttacagctatcatttctgcggctacgtttcactttat
tcgttttaccactatccatcttcaattcgactacgactttcccagttcatagttctacca
ccataccaatcaaacggacatggatctatgttgtattctcaaatattccaatatctgctg
acaaggccagaagttgcggagttaactctagaggatccgtcagaatcgtttgaggatttg
agagacagagaggatttgaaattgttgtttgacaacaaagtgtttgatgagaaaccgctc
agtgaattggtgcctgttccgagtgaatggtatgaaaagacgagaactaaatggaaattg
gctaataggcaatttgccaggttactagaaatggccctgcgatggaaattcacaacactt
gaagagtcagataatacaaaattagaacgactctatcgaatagcggttaaagagcgcctt
tatcggtttaactatgacagtctggtcgatctttccaaggaagaacgccgagaaaaatta
caagatactttccaaaacgtcatggatgattatgatcgccttttgcgaggtgaaagaagg
cagatcgattga

DBGET integrated database retrieval system